RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G028180
Reference: TK1151 Chr: Chr04 Coordinates: 7447882-7449940 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1425 bp · TkA04G028180|TK1151|cDNA

ATGAAACCAAGTATTGCAAGAGACGGACCACACACCATACCCACTTTCCAACCAACACCCCCTCCCCCACCAGGTCCCACCCCAATCCCAATCCACATAGAAGAAGAAACATGGCACTGGTTATGGAAAACTTCACTCATCGGTGAAGCAAAGTCCCTTGATCATTTGCGGCACATGCCAAAATTACTCAAATCAGGGAAGAAAGTCACAATGTCTATCAAGTATATCGGGGGATTGAATGTCCTTATAGAATTCGATGC...

CDS

Download CDS FASTA

1425 bp · TkA04G028180|TK1151|CDS

ATGAAACCAAGTATTGCAAGAGACGGACCACACACCATACCCACTTTCCAACCAACACCCCCTCCCCCACCAGGTCCCACCCCAATCCCAATCCACATAGAAGAAGAAACATGGCACTGGTTATGGAAAACTTCACTCATCGGTGAAGCAAAGTCCCTTGATCATTTGCGGCACATGCCAAAATTACTCAAATCAGGGAAGAAAGTCACAATGTCTATCAAGTATATCGGGGGATTGAATGTCCTTATAGAATTCGATGC...

Protein

Download Protein FASTA

474 aa · TkA04G028180|TK1151|PROTEIN

MKPSIARDGPHTIPTFQPTPPPPPGPTPIPIHIEEETWHWLWKTSLIGEAKSLDHLRHMPKLLKSGKKVTMSIKYIGGLNVLIEFDASKDAKEFLADGDRWKEHLRWLQWGEHTKHWHGRIAWKIIVGLLVNLWGERNFNAITKALGKTVTPYDKINHKVDLSCIKIGILTDRRTRINEDIFVSINGEVLTLGIVEFEEDWYPFRFDPRRNFYVDEYGNEIPMDAEQDAKNTGPITTLNVAMEEEEPEEGEIPPDDAVHS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G028180
TK1151 IDTkA04G028180
OH-1004 IDLXL04_007387
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)56.800
Protein coverage (%)TK1151 67.932 / OH-1004 63.602
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G028180
LocationChr04:7447882-7449940 (-)
DescriptionSimilar to SRSF2: Serine/arginine-rich splicing factor 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_007387 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process
GO:0000398 mRNA splicing, via spliceosome Biological Process
GO:0006397 mRNA processing Biological Process
GO:0008380 RNA splicing Biological Process
GO:0016554 cytidine to uridine editing Biological Process
GO:0080156 mitochondrial mRNA modification Biological Process
GO:1900871 chloroplast mRNA modification Biological Process
GO:0005634 nucleus Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005681 spliceosomal complex Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference
cel:CELE_EEED8.7
dosa:Os02g0730800
gga:396195
hsa:10929
osa:4330618
ptr:619467
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.513
Rank 1 · TkA04G028180 · TK1151
Cytoplasm0.460
Rank 2 · TkA04G028180 · TK1151
Cell membrane0.096
Rank 3 · TkA04G028180 · TK1151
Endoplasmic reticulum0.044
Rank 4 · TkA04G028180 · TK1151
Mitochondrion0.031
Rank 5 · TkA04G028180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser