RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G027180
Reference: TK1151 Chr: Chr04 Coordinates: 7176731-7178608 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1734 bp · TkA04G027180|TK1151|cDNA

AGTCAAAAAAAAAAAAAAACAATGTAACTAAAAAGATACAAGGCAAATGAGCATTTTGACAAGTTACTTTCTTCTAGAAAGGATGTCTTCCCTTTTTAAACACACTTTTATTGTTTACCCATCGAGTCATGTGTAATAGCTAAGCAATTTCTCTTTTGAACTACTCTCTTCCGCATACCAAGTGTGTGTTAGATGCTTCATCAGCAAGAAAAAATCAATCAATACCCCCTTCATCACGTACCTCAAATTGTCCACAGAAA...

CDS

Download CDS FASTA

1188 bp · TkA04G027180|TK1151|CDS

ATGGACGACGATCAAATTCCGGTGTTAGACCTCCGGCAATTAAAAGTCGTATCGGCGCTAGGTCGAGGAGCTAGGGGAGTTGTGTTTTTGGTGCAAGATGAGTTGTCTAATGGAGAATTCTTTGCTTTGAAGACTATTTTGAGAGGTTCGGTTGCGAGGAAAGTGAAGAAGACGGATGACGATGGTGGTGAGTGTAAGCAAATTTTGCTCGAGCAGGAGGTGTTGCGACTGTCGGAACATCCGTTGTTACCGAAACTCCG...

Protein

Download Protein FASTA

395 aa · TkA04G027180|TK1151|PROTEIN

MDDDQIPVLDLRQLKVVSALGRGARGVVFLVQDELSNGEFFALKTILRGSVARKVKKTDDDGGECKQILLEQEVLRLSEHPLLPKLRGVLSTESIVGYAIDYCPGRDLNCLRKRQTEKMFSDDIIRFYAAELVIALEYLHGLGIVYRDLKPENVMIQENGHLMLVDFDLSTKLSPKPPSVPRSPNPTTSPESEPLLKNKKRFSFFSSCFRPAIPAEDSVHPAESVDNSEQTCARHSFSKSNSFVGTEEYVAPEMLHGNGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G027180
TK1151 IDTkA04G027180
OH-1004 IDLXL04_036731
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G027180
LocationChr04:7176731-7178608 (+)
DescriptionSimilar to OXI1: Serine/threonine-protein kinase OXI1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g25250 Involved in oxidative burst-mediated signaling.
OXI1 kinase is necessary for oxidative burst-mediated signalling in Arabidopsis.2004 · DOI: 10.1038/nature02353
The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x
At1g51170 Regulates planar ovule integument development by suppressing aberrantly oriented growth. No verified direct reference in this release
At3g20830 Regulates planar ovule integument development. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0291600 May play a role in the regulation of metabolism and signal transduction processes. No verified direct reference in this release
UniProt: A2YBX5 May play a role in the regulation of metabolism and signal transduction processes. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036731 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0006952 defense response Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0009611 response to wounding Biological Process
GO:0036290 protein trans-autophosphorylation Biological Process
GO:0042542 response to hydrogen peroxide Biological Process
GO:0051782 negative regulation of cell division Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:0080060 integument development Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G51170
ath:AT3G20830
ath:AT3G25250
dosa:Os06g0291600
osa:4340792
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.618
Rank 1 · TkA04G027180 · TK1151
Nucleus0.447
Rank 2 · TkA04G027180 · TK1151
Cell membrane0.065
Rank 3 · TkA04G027180 · TK1151
Mitochondrion0.055
Rank 4 · TkA04G027180 · TK1151
Endoplasmic reticulum0.039
Rank 5 · TkA04G027180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14531Kinase-like12-49 aa
PF07714PK_Tyr_Ser-Thr15-174 aa
PF00069Pkinase16-177 aa
PF03109ABC1100-175 aa
PF14531Kinase-like113-169 aa
PF17667Pkinase_fungal133-176 aa
PF01636APH139-170 aa
PF17667Pkinase_fungal235-265 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G027180PF14531Kinase-like12492.8e-0627.5
TkA04G027180PF07714PK_Tyr_Ser-Thr151743.2e-2176.5
TkA04G027180PF00069Pkinase161771e-52179.9
TkA04G027180PF03109ABC11001750.01615.1
TkA04G027180PF14531Kinase-like1131692.8e-0627.5
TkA04G027180PF17667Pkinase_fungal1331760.005116.3
TkA04G027180PF01636APH1391700.01815.5
TkA04G027180PF17667Pkinase_fungal2352650.005116.3
TkA04G027180PF00069Pkinase2383361e-52179.9
TkA04G027180PF07714PK_Tyr_Ser-Thr2473313.2e-2176.5
TkA04G027180PF14531Kinase-like2623242.8e-0627.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LSF1Arabidopsis thalianasp|Q9LSF1|OXI1_ARATH Serine/threonine-protein kinase OXI156.600%Swiss-ProtHigh
Q9SYB9Arabidopsis thalianasp|Q9SYB9|UNC_ARATH Serine/threonine-protein kinase UCN44.900%Swiss-ProtMedium
Q9LT38Arabidopsis thalianasp|Q9LT38|UNCL_ARATH Serine/threonine-protein kinase UCNL41.800%Swiss-ProtMedium
Q0DCT8Oryza sativa subsp. japonicasp|Q0DCT8|G11A_ORYSJ Protein kinase G11A37.800%Swiss-ProtMedium
A2YBX5Oryza sativa subsp. indicasp|A2YBX5|G11A_ORYSI Protein kinase G11A37.500%Swiss-ProtMedium

JBrowse

View in Genome Browser