TkA04G026420 | RubberDandelionOmics

Gene overview

TkA04G026420

Reference: TK1151 Chr: Chr04 Coordinates: 6930104-6934730 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1700 bp · TkA04G026420|TK1151|cDNA

GAATACAAACCCAAAAAATTAATTTCAAATACAATTATTTATGTATACAACTTTACGTCTATATACTGCTATGATCATATTTTTATACAGTTTTATTTTAAGTTGTTTCTATTTTTCAACTTTAGGTTAAAATAACATTTATTCTTCTAATATAAGAAGAAACTCTATTTAGTTTTAGTACTCCCTCCGTTATCACTCCGTCCCATTTTTATTGTGTACCTTCCTATTTTTAATTGTCCCAAAATTATTGTCATTGCCAA...

CDS

Download CDS FASTA

858 bp · TkA04G026420|TK1151|CDS

ATGCACCCAAAATACGGAAACAATGATAGATGTTGCATTGACTATAAGCTCGTTGTGCGCTTGTGGCTGAAAATTTCTCACAGGATGCCGATGAAGCTTGTGAAGACTGAAGGGGTAAACGATCGTATAGCAATGCTGAAAGCCATGGCTGAAGTTCTTAATAAGAATAGGGCAAATGTGGTTAGCGGCCTCGGGTTTTCATCGATAAATGCTTACACTGTGCTATCCGAAATCAAATGGCGAGAGAAAGGCAAAAGTGG...

Protein

Download Protein FASTA

285 aa · TkA04G026420|TK1151|PROTEIN

MHPKYGNNDRCCIDYKLVVRLWLKISHRMPMKLVKTEGVNDRIAMLKAMAEVLNKNRANVVSGLGFSSINAYTVLSEIKWREKGKSGQLRKSKHHLIDNGGTSTPSKATIDRRISPDYEAMIFEALFSTKDPNGADTNEILSFIQQRYELPDNFKRSVTLMLRRLTLSGELEKVNNHFTIYKGESFSDEAPIEEDVGPCEDEKMDEKKEEMDKCDSPIGTETMEDAALYAAITVARAENTMQKAIEACQEADSFVEDVEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G026420`
TK1151 ID	TkA04G026420
OH-1004 ID	LXL04_036742
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G026420

Location Chr04:6930104-6934730 (-)

Description Similar to At1g72740: Telomere repeat-binding factor 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17520`	Binds preferentially double-stranded telomeric repeats.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036742 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006334 nucleosome assembly Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0000785 chromatin Cellular Component

GO:0000786 nucleosome Cellular Component

GO:0000791 euchromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003691 double-stranded telomeric DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G17520

ath:AT1G72740

zma:542123

zma:542125

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.685

Rank 1 · TkA04G026420 · TK1151

Cytoplasm0.304

Rank 2 · TkA04G026420 · TK1151

Cell membrane0.062

Rank 3 · TkA04G026420 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkA04G026420 · TK1151

Mitochondrion0.029

Rank 5 · TkA04G026420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27645Ninein_mid6-58 aa

PF00538Linker_histone116-176 aa

PF24920C2_TCB1221-278 aa

PF00538Linker_histone233-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G026420	`PF27645`	Ninein_mid	6	58	0.14	12.6
TkA04G026420	`PF00538`	Linker_histone	116	176	1.8e-08	35.2
TkA04G026420	`PF24920`	C2_TCB1	221	278	0.19	12.2
TkA04G026420	`PF00538`	Linker_histone	233	255	1.8e-08	35.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I7L1`	Arabidopsis thaliana	sp\|F4I7L1\|TRB4_ARATH Telomere repeat-binding factor 4	29.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card