Gene Card
Gene overview
cDNA / CDS / Protein Sequences
858 bp · LXL04_036742|LXL04_036742|OH1004|cDNA
ATGCACCCAAAATACGGAAACAATGATAGATGTTGCATTGACTATAAGCTCGTTGTGCGCTTGTGGCTGAAAATTTCTCACAGGATGCCGATGAAGCTTGTGAAGACTGAAGGGGTAAACGATCGTATAGCAATGCTGAAAGCCATGGCTGAAGTTCTTAATAAGAATAGGGCAAATGTGGTTAGCGGCCTCGGGTTTTCATCGATAAATGCTTACACTGTGCTATCCGaaatcaaatGGCGAGAGAAAGGCAAAAGTGG...
858 bp · LXL04_036742|LXL04_036742|OH1004|CDS
ATGCACCCAAAATACGGAAACAATGATAGATGTTGCATTGACTATAAGCTCGTTGTGCGCTTGTGGCTGAAAATTTCTCACAGGATGCCGATGAAGCTTGTGAAGACTGAAGGGGTAAACGATCGTATAGCAATGCTGAAAGCCATGGCTGAAGTTCTTAATAAGAATAGGGCAAATGTGGTTAGCGGCCTCGGGTTTTCATCGATAAATGCTTACACTGTGCTATCCGAAATCAAATGGCGAGAGAAAGGCAAAAGTGG...
Protein
Download Protein FASTA285 aa · LXL04_036742|LXL04_036742|OH1004|PROTEIN
MHPKYGNNDRCCIDYKLVVRLWLKISHRMPMKLVKTEGVNDRIAMLKAMAEVLNKNRANVVSGLGFSSINAYTVLSEIKWREKGKSGQLRKSKHHLIDNGGTSTPSKATIDRRISPDYEAMIFEALFSTKDPNGADTNEILSFIQQRYELPDNFKRSVTLMLRRLTLSGELEKVNNHFTIYKGESFSDEAPIEEDVGPCEDEKMDEKKEEMDKCDSPIGTETMEDAALYAAITVARAENTMQKAIEACQEADSFVEDVEE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036742 |
|---|---|
| TK1151 ID | TkA04G026420 |
| OH-1004 ID | LXL04_036742 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036742 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:47725655-47727779 (+) | |||||||||
| Description | Similar to At1g72740: Telomere repeat-binding factor 5 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006334 nucleosome assembly Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0000781 chromosome, telomeric region Cellular Component GO:0000785 chromatin Cellular Component GO:0000786 nucleosome Cellular Component GO:0000791 euchromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0003691 double-stranded telomeric DNA binding Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0042803 protein homodimerization activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G17520 ath:AT1G72740 zma:542123 zma:542125 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00538.26Linker_histone116-176 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036742 | PF00538.26 | Linker_histone | 116 | 176 | 1.8e-08 | 35.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.