TkA04G025060 | RubberDandelionOmics

Gene overview

TkA04G025060

Reference: TK1151 Chr: Chr04 Coordinates: 6534895-6537355 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1197 bp · TkA04G025060|TK1151|cDNA

CTTGTATTCATCATTCGAGTCTTCCCTAAATCAATAATCGATCATCAACATCATTTCATCTTTGATTCTCTTCGTATTTTCGAGAAAAAATGGAAATGGATTTTCCTGAAATAAACAAGAGATTGCTCGTTGAACTTGAAGAAATGGGGTTCCCATTAGCTCGAGCAATTAAAGCACTTCATTATTCCGGTAACTCTAGCTTACTAGATGCTCTTAATTGGCTTGTTGATCATGAGGATGACCCTGATATGGATCAAATG...

CDS

Download CDS FASTA

954 bp · TkA04G025060|TK1151|CDS

ATGGAAATGGATTTTCCTGAAATAAACAAGAGATTGCTCGTTGAACTTGAAGAAATGGGGTTCCCATTAGCTCGAGCAATTAAAGCACTTCATTATTCCGGTAACTCTAGCTTACTAGATGCTCTTAATTGGCTTGTTGATCATGAGGATGACCCTGATATGGATCAAATGCCATCGGTTCCTGTAAGAATTGAAATTGAGGGTTCTGAGTCTTGTTCCATTTCAGAAGAAGTAAAGCTAAAAGCACAAAAACTAAGAAT...

Protein

Download Protein FASTA

317 aa · TkA04G025060|TK1151|PROTEIN

MEMDFPEINKRLLVELEEMGFPLARAIKALHYSGNSSLLDALNWLVDHEDDPDMDQMPSVPVRIEIEGSESCSISEEVKLKAQKLRIKARKKNKEEDMKFEPRREKERIRSGKELQEAKRIREENERKRLLALREVEKEEDDKARERIRQKLHQDKAERREGNRIGLTPQNHASLKTTISIPMVEENKMLHVNSTTKVDVDLIRDCLRSLKHDNKDNEIKVKRAFETLLIYVRNVARNPDEDKFRKIRLSNPAFKERVGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G025060`
TK1151 ID	TkA04G025060
OH-1004 ID	LXL04_036772
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 99.369 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G025060`
Location	Chr04:6534895-6537355 (-)
Description	Similar to ubxn1: UBX domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036772` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0031397 negative regulation of protein ubiquitination Biological Process GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:1903094 negative regulation of protein K48-linked deubiquitination Biological Process GO:1904293 negative regulation of ERAD pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0034098 VCP-NPL4-UFD1 AAA ATPase complex Cellular Component GO:0031593 polyubiquitin modification-dependent protein binding Molecular Function GO:0031625 ubiquitin protein ligase binding Molecular Function
KEGG gene cross-reference	mmu:225896 rno:293719 xla:443814 xla:444653 xtr:448372 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.658

Rank 1 · TkA04G025060 · TK1151

Nucleus0.290

Rank 2 · TkA04G025060 · TK1151

Cell membrane0.113

Rank 3 · TkA04G025060 · TK1151

Golgi apparatus0.078

Rank 4 · TkA04G025060 · TK1151

Mitochondrion0.052

Rank 5 · TkA04G025060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22562UBA_71-7 aa

PF00627UBA1-7 aa

PF22562UBA_79-56 aa

PF00627UBA15-45 aa

PF29854MCM3AP_GANP_C70-213 aa

PF09409PUB220-289 aa

PF22562UBA_7287-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G025060	`PF22562`	UBA_7	1	7	5.9e-16	58.8
TkA04G025060	`PF00627`	UBA	1	7	7.4e-06	26.4
TkA04G025060	`PF22562`	UBA_7	9	56	5.9e-16	58.8
TkA04G025060	`PF00627`	UBA	15	45	7.4e-06	26.4
TkA04G025060	`PF29854`	MCM3AP_GANP_C	70	213	0.028	14.0
TkA04G025060	`PF09409`	PUB	220	289	4.1e-22	78.6
TkA04G025060	`PF22562`	UBA_7	287	305	5.9e-16	58.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card