Gene Card
Gene overview
cDNA / CDS / Protein Sequences
948 bp · LXL04_036772|LXL04_036772|OH1004|cDNA
ATGGATTTTCCTGAAATAAACAAGAGATTGCTCGTTGAACTTGAAGAAATGGGGTTCCCATTAGCTCGAGCAATTAAAGCACTTCATTATTCCGGTAACTCTAGCTTACTAGATGCTCTTAATTGGCTTGTTGATCATGAGGATGACCCTGATATGGATCAAATGCCATCGGTTCCTGTAAGAATTGAAATTGAGGGTTCTGAGTCTTGTTCCATTTCAGAAGAAGTAAAGCTAAAAGCACAAAAACTAAGAATTAAAGC...
948 bp · LXL04_036772|LXL04_036772|OH1004|CDS
ATGGATTTTCCTGAAATAAACAAGAGATTGCTCGTTGAACTTGAAGAAATGGGGTTCCCATTAGCTCGAGCAATTAAAGCACTTCATTATTCCGGTAACTCTAGCTTACTAGATGCTCTTAATTGGCTTGTTGATCATGAGGATGACCCTGATATGGATCAAATGCCATCGGTTCCTGTAAGAATTGAAATTGAGGGTTCTGAGTCTTGTTCCATTTCAGAAGAAGTAAAGCTAAAAGCACAAAAACTAAGAATTAAAGC...
Protein
Download Protein FASTA315 aa · LXL04_036772|LXL04_036772|OH1004|PROTEIN
MDFPEINKRLLVELEEMGFPLARAIKALHYSGNSSLLDALNWLVDHEDDPDMDQMPSVPVRIEIEGSESCSISEEVKLKAQKLRIKARKKNKEEDMKFEPRREKERIRSGKELQEAKRIREENERKRLLALREVEKEEDDKAREKIRQKLHQDKAERREGNRIGLTPQNHASLKTTISIPMVEENKMLHVNSTTKVDVDLIRDCLRSLKHDNKDNEIKVKRAFETLLIYVRNVARNPDEDKFRKIRLSNPAFKERVGIFK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036772 |
|---|---|
| TK1151 ID | TkA04G025060 |
| OH-1004 ID | LXL04_036772 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.400 |
| Protein coverage (%) | TK1151 99.369 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036772 |
|---|---|
| Location | Chr08:48146466-48148490 (+) |
| Description | Similar to ubxn1: UBX domain-containing protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0031397 negative regulation of protein ubiquitination Biological Process GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:1903094 negative regulation of protein K48-linked deubiquitination Biological Process GO:1904293 negative regulation of ERAD pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0034098 VCP-NPL4-UFD1 AAA ATPase complex Cellular Component GO:0031593 polyubiquitin modification-dependent protein binding Molecular Function GO:0031625 ubiquitin protein ligase binding Molecular Function |
| KEGG gene cross-reference | mmu:225896 rno:293719 xla:443814 xla:444653 xtr:448372 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF22562.3UBA_77-54 aaPF09409.16PUB218-287 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036772 | PF22562.3 | UBA_7 | 7 | 54 | 2.9e-16 | 59.8 |
| LXL04_036772 | PF09409.16 | PUB | 218 | 287 | 8.8e-22 | 77.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.