Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2184 bp · TkA04G022770|TK1151|cDNA
ATGATGAGGAATGTCATTTGCAAAAGGGCCGCAGCAAGACATGAATCAGGTGTAGAAGGGCTGTGCAACTGCAACATGACAGGGGGTAGCACAGGCTACCTCTGGTTCTTAATCAGTTCCGCCCCTGGGGGGGGGGGGCCTCAAAACCGATTGAATCAACAAGCGAAGCCAGTCGCCCAATCTTCACACAAACTCAAAAACTTTCAAATCATTTTCTTTGGCTCACGCGACTCCTTCCTTCGTTGGCTTGCATTTCTACA...
2184 bp · TkA04G022770|TK1151|CDS
ATGATGAGGAATGTCATTTGCAAAAGGGCCGCAGCAAGACATGAATCAGGTGTAGAAGGGCTGTGCAACTGCAACATGACAGGGGGTAGCACAGGCTACCTCTGGTTCTTAATCAGTTCCGCCCCTGGGGGGGGGGGGCCTCAAAACCGATTGAATCAACAAGCGAAGCCAGTCGCCCAATCTTCACACAAACTCAAAAACTTTCAAATCATTTTCTTTGGCTCACGCGACTCCTTCCTTCGTTGGCTTGCATTTCTACA...
Protein
Download Protein FASTA727 aa · TkA04G022770|TK1151|PROTEIN
MMRNVICKRAAARHESGVEGLCNCNMTGGSTGYLWFLISSAPGGGGPQNRLNQQAKPVAQSSHKLKNFQIIFFGSRDSFLRWLAFLHEIENRKIVDWLAETFKRDEGIDLLKDKQVLQRLNETAEKAKKELSTLTQTNIRYQATEWLKSFVGSLGISKQPSEKELISCLRKGLIFCNTISGVQPGSVPKGNYLMLLDVSYMTATKKLIMATLSSISGLASAMGPALDKSSKIDLHVNGMAQIKQATYGNVDMGFVPGVAE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G022770 |
|---|---|
| TK1151 ID | TkA04G022770 |
| OH-1004 ID | LXL04_036817 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 84.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G022770 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:5780238-5787862 (+) | |||||||||
| Description | Similar to ttc4: Tetratricopeptide repeat protein 4 homolog | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0042026 protein refolding Biological Process GO:0045087 innate immune response Biological Process GO:0051607 defense response to virus Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0045111 intermediate filament cytoskeleton Cellular Component GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function | |||||||||
| KEGG gene cross-reference | bta:509047 ddi:DDB_G0286253 hsa:7268 mmu:72354 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00012HSP7092-142 aaPF00307CH141-191 aaPF24078Beta-sol_PIC_HAP1_IgA0_2nd365-442 aaPF30993CABIN1_N396-427 aaPF25575TPR_BSK1_C398-475 aaPF13414TPR_11404-428 aaPF13181TPR_8410-427 aaPF07719TPR_2411-427 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G022770 | PF00012 | HSP70 | 92 | 142 | 1.4e-11 | 44.1 |
| TkA04G022770 | PF00307 | CH | 141 | 191 | 0.0038 | 18.1 |
| TkA04G022770 | PF24078 | Beta-sol_PIC_HAP1_IgA0_2nd | 365 | 442 | 0.13 | 12.7 |
| TkA04G022770 | PF30993 | CABIN1_N | 396 | 427 | 0.034 | 14.5 |
| TkA04G022770 | PF25575 | TPR_BSK1_C | 398 | 475 | 0.0012 | 19.4 |
| TkA04G022770 | PF13414 | TPR_11 | 404 | 428 | 0.0016 | 18.8 |
| TkA04G022770 | PF13181 | TPR_8 | 410 | 427 | 0.00012 | 22.6 |
| TkA04G022770 | PF07719 | TPR_2 | 411 | 427 | 3.8e-07 | 30.4 |
| TkA04G022770 | PF00515 | TPR_1 | 412 | 426 | 1.8e-06 | 28.3 |
| TkA04G022770 | PF12895 | ANAPC3 | 412 | 490 | 0.00019 | 22.4 |
| TkA04G022770 | PF13424 | TPR_12 | 415 | 466 | 0.19 | 12.6 |
| TkA04G022770 | PF13431 | TPR_17 | 438 | 457 | 0.026 | 15.5 |
| TkA04G022770 | PF07719 | TPR_2 | 439 | 470 | 3.8e-07 | 30.4 |
| TkA04G022770 | PF00515 | TPR_1 | 439 | 470 | 1.8e-06 | 28.3 |
| TkA04G022770 | PF13181 | TPR_8 | 439 | 469 | 0.00012 | 22.6 |
| TkA04G022770 | PF30993 | CABIN1_N | 442 | 514 | 0.034 | 14.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.