LXL04_036817 | RubberDandelionOmics

Gene overview

LXL04_036817

Reference: OH-1004 Chr: Chr08 Coordinates: 48784930-48792338 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2175 bp · LXL04_036817|LXL04_036817|OH1004|cDNA

ATGATGAGGAATGTCATTTGCAAAAGGGCCGCAGCAAGACATGAATCAGGTGTAGAAGGGCTGTGCAACTGCAACATGACAGGTTTTCGACCGCTGTTTTCTCTTCCACTATTTCTTGCCATATCTTCCTCCGATTATCCCTTTTTCTCCGATGAAGGTTTAAGTTTAGGTTTGTTCCATCTGCCCAACTTGCTCTACCTTCTTGGCGGTTTGGGCGATTTCTTCTTATCGGAGCCTCAAAACCGATTGAATCAACAAGC...

CDS

Download CDS FASTA

2175 bp · LXL04_036817|LXL04_036817|OH1004|CDS

ATGATGAGGAATGTCATTTGCAAAAGGGCCGCAGCAAGACATGAATCAGGTGTAGAAGGGCTGTGCAACTGCAACATGACAGGTTTTCGACCGCTGTTTTCTCTTCCACTATTTCTTGCCATATCTTCCTCCGATTATCCCTTTTTCTCCGATGAAGGTTTAAGTTTAGGTTTGTTCCATCTGCCCAACTTGCTCTACCTTCTTGGCGGTTTGGGCGATTTCTTCTTATCGGAGCCTCAAAACCGATTGAATCAACAAGC...

Protein

Download Protein FASTA

724 aa · LXL04_036817|LXL04_036817|OH1004|PROTEIN

MMRNVICKRAAARHESGVEGLCNCNMTGFRPLFSLPLFLAISSSDYPFFSDEGLSLGLFHLPNLLYLLGGLGDFFLSEPQNRLNQQAKPVAQSSHKLKNFQIIFFGSRDSFLRWLAFLHEIENRKIVDWLAETFKRDEGIDLLKDKQVLQRLNETAEKAKKELSTLTQTNIRYQATEWLKSFGNYLMLLDVSYMTATKKLIMATLSSISGLASAMGPALDKSSKVHFSYNYDPCHVNGMAQIKQATYGNVDMDFVPGVAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036817`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_036817`
Location	Chr08:48784930-48792338 (-)
Description	Similar to ttc4: Tetratricopeptide repeat protein 4 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036817` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0042026 protein refolding Biological Process GO:0045087 innate immune response Biological Process GO:0051607 defense response to virus Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0045111 intermediate filament cytoskeleton Cellular Component GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function
KEGG gene cross-reference	bta:509047 ddi:DDB_G0286253 hsa:7268 mmu:72354 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.356

Rank 1 · LXL04_036817 · OH-1004

Nucleus0.228

Rank 2 · LXL04_036817 · OH-1004

Mitochondrion0.184

Rank 3 · LXL04_036817 · OH-1004

Peroxisome0.124

Rank 4 · LXL04_036817 · OH-1004

Endoplasmic reticulum0.108

Rank 5 · LXL04_036817 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012.27HSP70124-174 aa

PF18972.6Wheel555-633 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036817	`PF00012.27`	HSP70	124	174	1.2e-11	44.3
LXL04_036817	`PF18972.6`	Wheel	555	633	2.2e-10	41.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card