TkA04G017110 | RubberDandelionOmics

Gene overview

TkA04G017110

Reference: TK1151 Chr: Chr04 Coordinates: 4252074-4253078 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1005 bp · TkA04G017110|TK1151|cDNA

ATGGCATCACCATCTCCGACAAAAATTATCGATAACGCGATATTTTGCAGCTCTATGTATACGTTAGTGTATACTGATCCTGACCAAAAATGGCTAATACGAAAGCACTTACTTTCCCTTCATAGTGAATTCTCTTCATTGTATCCTAATGTTAGCGTTTTCACCCACAATGATGGAACTATGGTGAACTTACTGAAAGCTGAAGGCTACCTCCATATCTCTCGGTCTTTGCCTTCGATTCATATAAGCATTTGGATCCA...

CDS

Download CDS FASTA

1005 bp · TkA04G017110|TK1151|CDS

ATGGCATCACCATCTCCGACAAAAATTATCGATAACGCGATATTTTGCAGCTCTATGTATACGTTAGTGTATACTGATCCTGACCAAAAATGGCTAATACGAAAGCACTTACTTTCCCTTCATAGTGAATTCTCTTCATTGTATCCTAATGTTAGCGTTTTCACCCACAATGATGGAACTATGGTGAACTTACTGAAAGCTGAAGGCTACCTCCATATCTCTCGGTCTTTGCCTTCGATTCATATAAGCATTTGGATCCA...

Protein

Download Protein FASTA

334 aa · TkA04G017110|TK1151|PROTEIN

MASPSPTKIIDNAIFCSSMYTLVYTDPDQKWLIRKHLLSLHSEFSSLYPNVSVFTHNDGTMVNLLKAEGYLHISRSLPSIHISIWIHEHYPHMAPIVQVSPNPTYQIRPNHPFVDPSGLTTSSYLHMWGPFGHDLLGLANSLVKLFSLDHPFYYVNAPTLSHPSYMSKRDCMDRLWYMLHYDMITLRENTDDEIEKLTILQAEMSMRVDTTTSIIIGLDHEMVNLKQRVNEMTGESDILINWLAVNKVNLSVAMGGKVAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G017110`
TK1151 ID	TkA04G017110
OH-1004 ID	LXL04_036927
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G017110`
Location	Chr04:4252074-4253078 (+)
Description	Similar to ELCL: Protein ELC-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036927` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006858 extracellular transport Biological Process GO:0007175 negative regulation of epidermal growth factor-activated receptor activity Biological Process GO:0008333 endosome to lysosome transport Biological Process GO:0009611 response to wounding Biological Process GO:0010091 trichome branching Biological Process GO:0015031 protein transport Biological Process GO:0016236 macroautophagy Biological Process GO:0019076 viral release from host cell Biological Process GO:0036258 multivesicular body assembly Biological Process GO:0039702 viral budding via host ESCRT complex Biological Process GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway Biological Process GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process
KEGG gene cross-reference	ath:AT3G12400 ath:AT5G13860 ddi:DDB_G0286797 hsa:7251 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.595

Rank 1 · TkA04G017110 · TK1151

Cytoplasm0.488

Rank 2 · TkA04G017110 · TK1151

Lysosome / Vacuole0.051

Rank 3 · TkA04G017110 · TK1151

Cell membrane0.044

Rank 4 · TkA04G017110 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA04G017110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05743UEV28-153 aa

PF05773RWD59-103 aa

PF00179UQ_con81-145 aa

PF09454Vps23_core260-322 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G017110	`PF05743`	UEV	28	153	1.4e-23	83.8
TkA04G017110	`PF05773`	RWD	59	103	0.024	15.5
TkA04G017110	`PF00179`	UQ_con	81	145	0.23	11.8
TkA04G017110	`PF09454`	Vps23_core	260	322	2.2e-18	66.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card