Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1005 bp · LXL04_036927|LXL04_036927|OH1004|cDNA
ATGGCATCACCATCTCCGACAAAAATTATCGATAACGCGATATTTTGCAGCTCTATGTATACGTTAGTGTATACTGATCCTGACCAAAAATGGCTAATACGAAAGCACTTACTTTCCCTTCATAGTGAATTCTCTTCATTGTATCCTAATGTTAGCGTTTTCACCCACAATGATGGAACTATGGTGAACTTACTGAAAGCTGAAGGCTACCTCCATATCTCTCGGTCTTTGCCTTCGATTCATATAAGCATTTGGATCCA...
1005 bp · LXL04_036927|LXL04_036927|OH1004|CDS
ATGGCATCACCATCTCCGACAAAAATTATCGATAACGCGATATTTTGCAGCTCTATGTATACGTTAGTGTATACTGATCCTGACCAAAAATGGCTAATACGAAAGCACTTACTTTCCCTTCATAGTGAATTCTCTTCATTGTATCCTAATGTTAGCGTTTTCACCCACAATGATGGAACTATGGTGAACTTACTGAAAGCTGAAGGCTACCTCCATATCTCTCGGTCTTTGCCTTCGATTCATATAAGCATTTGGATCCA...
Protein
Download Protein FASTA334 aa · LXL04_036927|LXL04_036927|OH1004|PROTEIN
MASPSPTKIIDNAIFCSSMYTLVYTDPDQKWLIRKHLLSLHSEFSSLYPNVSVFTHNDGTMVNLLKAEGYLHISRSLPSIHISIWIHEHYPHMAPIVQVSPNPTYQIRPNHPFVDPSGLTTSSYLHMWGPFGHDLLGLANSLVKLFSLDHPFYYVNAPTLSHPSYMSKRDCMDRLWYMLHYDMITLRENTDDEIEKLTILQAEMSMRVDTTTSIIIGLDHEMVNLKQRVNEMTGESDILINWLAVNKVNLSVAMGGKVAD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036927 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036927 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:50209799-50210803 (-) | |||||||||
| Description | Similar to ELCL: Protein ELC-like | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006858 extracellular transport Biological Process GO:0007175 negative regulation of epidermal growth factor-activated receptor activity Biological Process GO:0008333 endosome to lysosome transport Biological Process GO:0009611 response to wounding Biological Process GO:0010091 trichome branching Biological Process GO:0015031 protein transport Biological Process GO:0016236 macroautophagy Biological Process GO:0019076 viral release from host cell Biological Process GO:0036258 multivesicular body assembly Biological Process GO:0039702 viral budding via host ESCRT complex Biological Process GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway Biological Process GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G12400 ath:AT5G13860 ddi:DDB_G0286797 hsa:7251 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05743.20UEV28-153 aaPF09454.16Vps23_core260-322 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036927 | PF05743.20 | UEV | 28 | 153 | 1.4e-23 | 83.8 |
| LXL04_036927 | PF09454.16 | Vps23_core | 260 | 322 | 2.2e-18 | 66.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.