TkA04G014540 | RubberDandelionOmics

Gene overview

TkA04G014540

Reference: TK1151 Chr: Chr04 Coordinates: 3644362-3648563 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2304 bp · TkA04G014540|TK1151|cDNA

GTCACTTTGCTCAAAAATCTATACATAAAGCTACTCCAGTCCTACTCCACCTCCAAGTCCACTGCCATCTCAGCCACCGACAACAACCGAAAACACAGAATCAAAAATCGAAGAGCTCTTACACAATTCACAAATGATCACCGGAGAATATGGCAACCCGAAATCAAACTTCCGGCAACAACCGCACAGAGTTGCCATTCCGCCGCCACAACCATTCATAAAATCACTGAAGAACACCGTGAAAGAAACATTTTTTCCCG...

CDS

Download CDS FASTA

1173 bp · TkA04G014540|TK1151|CDS

ATGGCTCCATTCACATCGGTGATTTTGGCCAGCGCTCTTGTCTATTTGACTCGTGCCAATAAACATGGGGTTCAAGTGATTGGGGAATTAAAGAAAGGACTAAACCCCGTTACAATAAAGGACTTGTCTTTTGGGTCACAATATCTATCTATGGTAATCAAAACTGGTATCGTCACTGGAGTTATTGCCCTTGCTGAAGGAATGGCCGTGGGAAGAAGCTTTGCCATGCTCAAGAATTACAACATTGATGGTAATAAAGA...

Protein

Download Protein FASTA

390 aa · TkA04G014540|TK1151|PROTEIN

MAPFTSVILASALVYLTRANKHGVQVIGELKKGLNPVTIKDLSFGSQYLSMVIKTGIVTGVIALAEGMAVGRSFAMLKNYNIDGNKEMIAFGMMNIVGSCTSCYVTTGPFSRSAVNFNAGCKTAMSNIVMAVTVMITLLFLTPLFHYTPIVVLSSIIISAMLGLINYKEAIHLWSLDKFDFVVCMSGFFGVVFWTVEIGLIIAVALSLLRVLLFVARPKIFALGHIPDSSIYRSIDQYQNAETVSGILILQIDAPIYFAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G014540`
TK1151 ID	TkA04G014540
OH-1004 ID	LXL04_036948
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.100
Protein coverage (%)	TK1151 100.000 / OH-1004 15.965 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G014540

Location Chr04:3644362-3648563 (-)

Description Similar to SULTR3;1: Sulfate transporter 3.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51895`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At4g02700`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At3g15990`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At5g19600`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At1g23090`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036948 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008271 secondary active sulfate transmembrane transporter activity Molecular Function

GO:0015116 sulfate transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G51895

ath:AT4G02700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.632

Rank 1 · TkA04G014540 · TK1151

Cytoplasm0.142

Rank 2 · TkA04G014540 · TK1151

Lysosome / Vacuole0.141

Rank 3 · TkA04G014540 · TK1151

Endoplasmic reticulum0.084

Rank 4 · TkA04G014540 · TK1151

Golgi apparatus0.059

Rank 5 · TkA04G014540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00916Sulfate_transp1-185 aa

PF05198IF3_N161-182 aa

PF13466STAS_2194-216 aa

PF01740STAS239-356 aa

PF13466STAS_2284-340 aa

PF05198IF3_N303-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G014540	`PF00916`	Sulfate_transp	1	185	5.7e-62	210.4
TkA04G014540	`PF05198`	IF3_N	161	182	0.034	15.0
TkA04G014540	`PF13466`	STAS_2	194	216	0.00026	21.9
TkA04G014540	`PF01740`	STAS	239	356	1e-26	93.5
TkA04G014540	`PF13466`	STAS_2	284	340	0.00026	21.9
TkA04G014540	`PF05198`	IF3_N	303	331	0.034	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV13`	Arabidopsis thaliana	sp\|Q9SV13\|SUT31_ARATH Sulfate transporter 3.1	70.400%	Swiss-Prot	High
`O04289`	Arabidopsis thaliana	sp\|O04289\|SUT32_ARATH Sulfate transporter 3.2	64.800%	Swiss-Prot	High
`Q9LW86`	Arabidopsis thaliana	sp\|Q9LW86\|SUT34_ARATH Probable sulfate transporter 3.4	53.900%	Swiss-Prot	High
`Q94LW6`	Arabidopsis thaliana	sp\|Q94LW6\|SUT35_ARATH Probable sulfate transporter 3.5	52.500%	Swiss-Prot	High
`Q9SXS2`	Arabidopsis thaliana	sp\|Q9SXS2\|SUT33_ARATH Probable sulfate transporter 3.3	51.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card