TkA04G013990 | RubberDandelionOmics

Gene overview

TkA04G013990

Reference: TK1151 Chr: Chr04 Coordinates: 3490942-3493101 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1732 bp · TkA04G013990|TK1151|cDNA

CAGCAAGTCAAACATGGAAGTCAAAGGGAGAGTTTGCTTAGTTCTGTCGTTGTTTATAGCTGTGTGCCTTGTTTCCGCCACCGTGAGTGTCGCTCGGAGCAATCGAGATCCAGATTACGGCGATTGCAAGCTCAAATGCGAGAGGGAGATTCGGGGAGTGGAGACGGAAGAGAAGGTACGAAAGTGTAAGCAGGTTTGCGAAAGGGAACATGAAGAGAAGAGGAGGGAAAAGGAAGGTGGACAATATGACATCGTTTTCG...

CDS

Download CDS FASTA

1014 bp · TkA04G013990|TK1151|CDS

ATGGAAGTCAAAGGGAGAGTTTGCTTAGTTCTGTCGTTGTTTATAGCTGTGTGCCTTGTTTCCGCCACCGTGAGTGTCGCTCGGAGCAATCGAGATCCAGATTACGGCGATTGCAAGCTCAAATGCGAGAGGGAGATTCGGGGAGTGGAGACGGAAGAGAAGGTACGAAAGTGTAAGCAGGTTTGCGAAAGGGAACATGAAGAGAAGAGGAGGGAAAAGGAAGGTGGACAATATGACATCGTTTTCGCGGATATTGAAGA...

Protein

Download Protein FASTA

337 aa · TkA04G013990|TK1151|PROTEIN

MEVKGRVCLVLSLFIAVCLVSATVSVARSNRDPDYGDCKLKCEREIRGVETEEKVRKCKQVCEREHEEKRREKEGGQYDIVFADIEEELREMVGKCHQSCKGSQGEQENPECFQKCMEKFQPEQEKRRVGGGSGRDTSRKSGRGYGKGQQLNNPYVFEDRHFTTKLESEQGSVRFLQKFTDRSELFQGIGKYRVAILEAQPQTFIIPNHWDADALIYVVNGEGSISLVNTDSRENHNIKRGDIFRVPAGYSAYLINRHNN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G013990`
TK1151 ID	TkA04G013990
OH-1004 ID	LXL04_036954
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.900
Protein coverage (%)	TK1151 97.626 / OH-1004 56.724 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G013990`
Location	Chr04:3490942-3493101 (+)
Description	Similar to AMP2-1: Vicilin-like antimicrobial peptides 2-1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036954` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0010431 seed maturation Biological Process GO:0031640 killing of cells of another organism Biological Process GO:0034214 protein hexamerization Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050832 defense response to fungus Biological Process GO:0070207 protein homotrimerization Biological Process GO:0005576 extracellular region Cellular Component GO:0043245 extraorganismal space Cellular Component GO:0005507 copper ion binding Molecular Function GO:0019863 IgE binding Molecular Function GO:0045735 nutrient reservoir activity Molecular Function
KEGG gene cross-reference	jre:108986502 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.324

Rank 1 · TkA04G013990 · TK1151

Lysosome / Vacuole0.285

Rank 2 · TkA04G013990 · TK1151

Endoplasmic reticulum0.274

Rank 3 · TkA04G013990 · TK1151

Cytoplasm0.147

Rank 4 · TkA04G013990 · TK1151

Nucleus0.054

Rank 5 · TkA04G013990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28318FANCB_C40-71 aa

PF28318FANCB_C96-128 aa

PF07883Cupin_2198-260 aa

PF00190Cupin_1202-310 aa

PF05899Cupin_3209-252 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G013990	`PF28318`	FANCB_C	40	71	0.33	11.7
TkA04G013990	`PF28318`	FANCB_C	96	128	0.33	11.7
TkA04G013990	`PF07883`	Cupin_2	198	260	0.00038	20.8
TkA04G013990	`PF00190`	Cupin_1	202	310	8.9e-10	39.0
TkA04G013990	`PF05899`	Cupin_3	209	252	0.12	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card