LXL04_036954 | RubberDandelionOmics

Gene overview

LXL04_036954

Reference: OH-1004 Chr: Chr08 Coordinates: 50833128-50835299 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1743 bp · LXL04_036954|LXL04_036954|OH1004|cDNA

ATGCATGCTGCCACCTCATCTTTCCTCCAGACACCTCAACATGATCAATTACACAACTCTCACTATATATACATATCGATGATTGTAAGACAAATCAGCAAGTCAAACATGGAAGTCAAAGGGAGAGTTTGCTTAGTTCTGTCGTTGTTTATAGCTGTGTGCCTTGTTTCCGCCACCGTGAGTGTCGCTCGGAGCAATCGAGATCCAGATTACGGCGATTGCAAGCTCAAATGCGAGAGGGAGATTCGGGGAGTGGAGAC...

CDS

Download CDS FASTA

1743 bp · LXL04_036954|LXL04_036954|OH1004|CDS

ATGCATGCTGCCACCTCATCTTTCCTCCAGACACCTCAACATGATCAATTACACAACTCTCACTATATATACATATCGATGATTGTAAGACAAATCAGCAAGTCAAACATGGAAGTCAAAGGGAGAGTTTGCTTAGTTCTGTCGTTGTTTATAGCTGTGTGCCTTGTTTCCGCCACCGTGAGTGTCGCTCGGAGCAATCGAGATCCAGATTACGGCGATTGCAAGCTCAAATGCGAGAGGGAGATTCGGGGAGTGGAGAC...

Protein

Download Protein FASTA

580 aa · LXL04_036954|LXL04_036954|OH1004|PROTEIN

MHAATSSFLQTPQHDQLHNSHYIYISMIVRQISKSNMEVKGRVCLVLSLFIAVCLVSATVSVARSNRDPDYGDCKLKCEREIRGVETEEKVRKCKQVFEREHEEKRREKEGGQYDIVFADIEEELREMVGKCHQSCKGGQGEQENPECFQKCMEKFQPEQEKRRGGGGSGRDTSRKSGRGYGKGQQLNNPYVFEDRHFTTKLESEQGSVRFLQKFTDRSELFQGIGKYRVAILEAQPQTFIIPNHWDADALIYVVNGEGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036954`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_036954`
Location	Chr08:50833128-50835299 (-)
Description	Similar to AMP2-1: Vicilin-like antimicrobial peptides 2-1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036954` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0010431 seed maturation Biological Process GO:0031640 killing of cells of another organism Biological Process GO:0034214 protein hexamerization Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050832 defense response to fungus Biological Process GO:0070207 protein homotrimerization Biological Process GO:0005576 extracellular region Cellular Component GO:0043245 extraorganismal space Cellular Component GO:0005507 copper ion binding Molecular Function GO:0019863 IgE binding Molecular Function GO:0045735 nutrient reservoir activity Molecular Function
KEGG gene cross-reference	jre:108986502 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.403

Rank 1 · LXL04_036954 · OH-1004

Endoplasmic reticulum0.300

Rank 2 · LXL04_036954 · OH-1004

Extracellular0.239

Rank 3 · LXL04_036954 · OH-1004

Cytoplasm0.161

Rank 4 · LXL04_036954 · OH-1004

Cell membrane0.072

Rank 5 · LXL04_036954 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190.29Cupin_1238-346 aa

PF00190.29Cupin_1392-557 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036954	`PF00190.29`	Cupin_1	238	346	1.5e-35	122.7
LXL04_036954	`PF00190.29`	Cupin_1	392	557	1.5e-35	122.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card