TkA04G012280 | RubberDandelionOmics

Gene overview

TkA04G012280

Reference: TK1151 Chr: Chr04 Coordinates: 3064640-3071238 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3252 bp · TkA04G012280|TK1151|cDNA

CGCCTAATATATGTTTTCTATATTTTGAGCCACGTGAAATTAGTGGCGGGAATGGAGGTCTTCCACTACCGACAAATCTACACACAGATAAGAAAAAGAGAGATCTCAGGATAACACACACACACACACCTCCACAGAAATCTGAAGATAACACACACACACACACACACACACACTTATCTTTCTGTTTGCACATCTTCTTCAACCTCTGGATCCAAAAACCCTAATGGTATCCCTCCTCCACCGTTCAATTTCATTCC...

CDS

Download CDS FASTA

2739 bp · TkA04G012280|TK1151|CDS

ATGGTATCCCTCCTCCACCGTTCAATTTCATTCCACACCCCATCCCATCTCCCACTCTTCACCCACCTCAACCACCACCACCACCACCATCGTACTCCCTCTCTATTAAATCTCCACCATCGTCACCCCGCCACTTCCCTCATAACCTGCATCGAGAAGAACGGCTCCTTCATCTCAAACAACAATGATCAACAGCCCCAGCGAACGCTGTTCCCCGGTGGTTACAAGCGGCCGGAAATCAAAATTCCCAATGTTGTGCT...

Protein

Download Protein FASTA

912 aa · TkA04G012280|TK1151|PROTEIN

MVSLLHRSISFHTPSHLPLFTHLNHHHHHHRTPSLLNLHHRHPATSLITCIEKNGSFISNNNDQQPQRTLFPGGYKRPEIKIPNVVLQLNPEDVLDDGKDVLGVVDQAVSGVVGVVVLNGGDGSGRNLYEAACLLKSVIRDRAYFLIAERVDIATAVNASGVVVSDQGLPAIVARNTIMDSKSDSVFLPLVGRNVQSLDAAMNTSTFEGADFLIYGEETIEKISVSMINQIKIPTFFTVNSNNKDKLSNDISYLLQSGAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G012280`
TK1151 ID	TkA04G012280
OH-1004 ID	LXL04_036980
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G012280

Location Chr04:3064640-3071238 (-)

Description Similar to FZL: Probable transmembrane GTPase FZO-like, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03160`	Probable membrane-remodeling GTPase that plays a unique role in the in the determination of thylakoid and chloroplast morphology and regulates organization of the thylakoid network.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036980 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008053 mitochondrial fusion Biological Process

GO:0009228 thiamine biosynthetic process Biological Process

GO:0009229 thiamine diphosphate biosynthetic process Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0034051 negative regulation of plant-type hypersensitive response Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT1G03160

cjj:CJJ81176_0436

nph:NP_4054A

npu:Npun_R6513

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.937

Rank 1 · TkA04G012280 · TK1151

Mitochondrion0.067

Rank 2 · TkA04G012280 · TK1151

Cytoplasm0.034

Rank 3 · TkA04G012280 · TK1151

Nucleus0.030

Rank 4 · TkA04G012280 · TK1151

Cell membrane0.021

Rank 5 · TkA04G012280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02581TMP-TENI97-216 aa

PF00735Septin117-168 aa

PF26975DUF8308314-362 aa

PF05049IIGP330-378 aa

PF03193RsgA_GTPase352-384 aa

PF00005ABC_tran353-387 aa

PF00735Septin357-392 aa

PF00350Dynamin_N359-405 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G012280	`PF02581`	TMP-TENI	97	216	4.1e-08	33.5
TkA04G012280	`PF00735`	Septin	117	168	0.0032	17.5
TkA04G012280	`PF26975`	DUF8308	314	362	0.049	14.2
TkA04G012280	`PF05049`	IIGP	330	378	0.00083	19.3
TkA04G012280	`PF03193`	RsgA_GTPase	352	384	0.0002	21.9
TkA04G012280	`PF00005`	ABC_tran	353	387	0.17	13.2
TkA04G012280	`PF00735`	Septin	357	392	0.0032	17.5
TkA04G012280	`PF00350`	Dynamin_N	359	405	7.2e-23	82.1
TkA04G012280	`PF00009`	GTP_EFTU	359	534	2e-07	31.5
TkA04G012280	`PF02421`	FeoB_N	359	380	0.0058	16.9
TkA04G012280	`PF01926`	MMR_HSR1	360	492	1e-14	55.3
TkA04G012280	`PF00350`	Dynamin_N	411	492	7.2e-23	82.1
TkA04G012280	`PF05049`	IIGP	426	536	0.00083	19.3
TkA04G012280	`PF02421`	FeoB_N	428	497	0.0058	16.9
TkA04G012280	`PF03193`	RsgA_GTPase	438	520	0.0002	21.9
TkA04G012280	`PF00735`	Septin	457	526	0.0032	17.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1KPV0`	Arabidopsis thaliana	sp\|Q1KPV0\|FZL_ARATH Probable transmembrane GTPase FZO-like, chloroplastic	55.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card