LXL04_036980 | RubberDandelionOmics

Gene overview

LXL04_036980

Reference: OH-1004 Chr: Chr08 Coordinates: 51189716-51195842 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2739 bp · LXL04_036980|LXL04_036980|OH1004|cDNA

ATGGTATCCCTCCTCCACCGTTCAATTTCATTCCACACCCCATCCCATCTCCCACTCTTCACCCAcctcaaccaccaccaccaccaccatcgtACTCCCTCTCTATTAAATCTCCACCATCGTCACCCCGCCACTTCCCTCATAACCTGCATCGAGAAGAACGGCTCCTTCATCTCAAACAACAATGATCAACAGCCCCAGCGAACGCTGTTCCCCGGTGGTTACAAGCGGCCGGAAATCAAAATTCCCAATGTTGTGCT...

CDS

Download CDS FASTA

2739 bp · LXL04_036980|LXL04_036980|OH1004|CDS

ATGGTATCCCTCCTCCACCGTTCAATTTCATTCCACACCCCATCCCATCTCCCACTCTTCACCCACCTCAACCACCACCACCACCACCATCGTACTCCCTCTCTATTAAATCTCCACCATCGTCACCCCGCCACTTCCCTCATAACCTGCATCGAGAAGAACGGCTCCTTCATCTCAAACAACAATGATCAACAGCCCCAGCGAACGCTGTTCCCCGGTGGTTACAAGCGGCCGGAAATCAAAATTCCCAATGTTGTGCT...

Protein

Download Protein FASTA

912 aa · LXL04_036980|LXL04_036980|OH1004|PROTEIN

MVSLLHRSISFHTPSHLPLFTHLNHHHHHHRTPSLLNLHHRHPATSLITCIEKNGSFISNNNDQQPQRTLFPGGYKRPEIKIPNVVLQLNPEDVLDDGKDVLGVVDQAVSGVVGVVVLNGGDGSGRNLYEAACLLKSVIRDRAYFLIAERVDIATAVNASGVVVSDQGLPAIVARNTIMDSKSDSVFLPLVGRNVQSLDAAMNTSTFEGADFLIYGEETIEKISVSMINQIKIPTFFTVNSNNKDKLSNDISYLLQSGAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036980`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036980

Location Chr08:51189716-51195842 (+)

Description Similar to FZL: Probable transmembrane GTPase FZO-like, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03160`	Probable membrane-remodeling GTPase that plays a unique role in the in the determination of thylakoid and chloroplast morphology and regulates organization of the thylakoid network.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036980 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008053 mitochondrial fusion Biological Process

GO:0009228 thiamine biosynthetic process Biological Process

GO:0009229 thiamine diphosphate biosynthetic process Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0034051 negative regulation of plant-type hypersensitive response Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT1G03160

cjj:CJJ81176_0436

nph:NP_4054A

npu:Npun_R6513

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.937

Rank 1 · LXL04_036980 · OH-1004

Mitochondrion0.067

Rank 2 · LXL04_036980 · OH-1004

Cytoplasm0.034

Rank 3 · LXL04_036980 · OH-1004

Nucleus0.030

Rank 4 · LXL04_036980 · OH-1004

Cell membrane0.021

Rank 5 · LXL04_036980 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02581.24TMP-TENI97-216 aa

PF00350.30Dynamin_N359-405 aa

PF00009.34GTP_EFTU359-534 aa

PF01926.30MMR_HSR1360-492 aa

PF00350.30Dynamin_N411-492 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036980	`PF02581.24`	TMP-TENI	97	216	4.1e-08	33.5
LXL04_036980	`PF00350.30`	Dynamin_N	359	405	7.2e-23	82.1
LXL04_036980	`PF00009.34`	GTP_EFTU	359	534	2e-07	31.5
LXL04_036980	`PF01926.30`	MMR_HSR1	360	492	1e-14	55.3
LXL04_036980	`PF00350.30`	Dynamin_N	411	492	7.2e-23	82.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1KPV0`	Arabidopsis thaliana	Probable transmembrane GTPase FZO-like, chloroplastic	55.634%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card