Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2517 bp · TkA04G012200|TK1151|cDNA
TTTTATATAATACAAAAATGGTTTTTATCTAAACTGAACGTGTTACGTGTTATCCTACCGAGGACTAAATTTAGAAGTCGTAAACTTCATCTCCCTTTACCATTTCAGTGATGAACCCTAAAAACCAAATTAATAGCAATTAGATTCACAGAGAGGTTTCTCAATCGGTAGTTCGAAATGATGGTTTATTCATCATTTTTGCCGGTGAATTTAACGGAATGAATTCCTAATTTAGAGCAATAACATTCATAACCGGATGA...
3870 bp · TkA04G012200|TK1151|CDS
ATGGGCACATTAAGCAGCGATCTCTTCTACGACATTCTAAAACGTCTCGATGGTGCAACCCTAGCTAGTGCATCATGCGCATGTGCAGCTTTTAGTTCAATGTCAAAAGAAGAGCGATTATGGGAAGATGTATGTTCTTCAATGTGGCCTTCAACAAAAAGAGACGACGTCAGAAACTTGATTCTATCAATCGGCGGATTTAAAAAATTCTATGGAGATTGTTTCCCTTTAATTGTGAACAAAGAGGTTCCCGAGTCTAG...
Protein
Download Protein FASTA1289 aa · TkA04G012200|TK1151|PROTEIN
MGTLSSDLFYDILKRLDGATLASASCACAAFSSMSKEERLWEDVCSSMWPSTKRDDVRNLILSIGGFKKFYGDCFPLIVNKEVPESRWSEYPEDYEELSEAEYYGDVDEFENVSPSDFVSMVDIKYKDKTICSKVIWGIPNANGFNGGVTLSVTDGLPMVTSMERERKDGKLWKHLGDGMRLSWIVVNKKVKQAANLSSWSALTGQRHFPTDKDFLLRFGSILPAKDILPCQMVECILAMKFQVITEGATGAHTTLKLTE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G012200 |
|---|---|
| TK1151 ID | TkA04G012200 |
| OH-1004 ID | LXL04_036986 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 94.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 99.182Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G012200 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:3013667-3025992 (+) | |||||||||
| Description | Similar to VPS11: Vacuolar protein-sorting-associated protein 11 homolog | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0006904 vesicle docking involved in exocytosis Biological Process GO:0007032 endosome organization Biological Process GO:0007033 vacuole organization Biological Process GO:0008333 endosome to lysosome transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031647 regulation of protein stability Biological Process GO:0032889 regulation of vacuole fusion, non-autophagic Biological Process GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process GO:0034058 endosomal vesicle fusion Biological Process GO:0035542 regulation of SNARE complex assembly Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G05170 cel:CELE_R06F6.2 ddi:DDB_G0278141 hsa:55823 mmu:71732 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00646F-box4-42 aaPF12937F-box-like8-45 aaPF00515TPR_1287-301 aaPF23341PEP5_VPS11_N401-443 aaPF23266VPS11_N423-445 aaPF23266VPS11_N444-700 aaPF23341PEP5_VPS11_N444-705 aaPF25171Beta-prop_WDR36-Utp21_1st503-588 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G012200 | PF00646 | F-box | 4 | 42 | 0.082 | 13.6 |
| TkA04G012200 | PF12937 | F-box-like | 8 | 45 | 0.00094 | 19.6 |
| TkA04G012200 | PF00515 | TPR_1 | 287 | 301 | 9.6 | 6.9 |
| TkA04G012200 | PF23341 | PEP5_VPS11_N | 401 | 443 | 4.4e-74 | 250.3 |
| TkA04G012200 | PF23266 | VPS11_N | 423 | 445 | 4.6e-95 | 319.0 |
| TkA04G012200 | PF23266 | VPS11_N | 444 | 700 | 4.6e-95 | 319.0 |
| TkA04G012200 | PF23341 | PEP5_VPS11_N | 444 | 705 | 4.4e-74 | 250.3 |
| TkA04G012200 | PF25171 | Beta-prop_WDR36-Utp21_1st | 503 | 588 | 0.014 | 15.6 |
| TkA04G012200 | PF28737 | VPS18_solenoid_2nd | 715 | 863 | 6.6e-16 | 59.5 |
| TkA04G012200 | PF13424 | TPR_12 | 728 | 762 | 1.4 | 9.8 |
| TkA04G012200 | PF07719 | TPR_2 | 739 | 762 | 1.2 | 10.1 |
| TkA04G012200 | PF23356 | TPR_PEP5_VPS11 | 750 | 1134 | 1.9e-85 | 288.0 |
| TkA04G012200 | PF23556 | TPR_Vps41 | 756 | 886 | 1.4e-08 | 35.0 |
| TkA04G012200 | PF00637 | Clathrin | 770 | 908 | 2.5e-12 | 47.5 |
| TkA04G012200 | PF00515 | TPR_1 | 810 | 820 | 9.6 | 6.9 |
| TkA04G012200 | PF13424 | TPR_12 | 848 | 882 | 1.4 | 9.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.