TkA04G012130 | RubberDandelionOmics

Gene overview

TkA04G012130

Reference: TK1151 Chr: Chr04 Coordinates: 2990138-2992521 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1166 bp · TkA04G012130|TK1151|cDNA

GTTGAAAAATAAACGTGGTTCATGCGCAGGGCATACTTTCTGTTGCATGTACGTACAGAAACACACAGAAGAAAACCAGCGAGCGACTGTCGTAACCTTCGAATCCCCAAAATCTTTCCAATTTCTACCAAAACCCTAAAATTATCAGTTCTCCGGGAAATGTTAACTTCATAAGTTTTTTTCGATGATTTTGGGTGTTTGATAGAGGTTTCACTCTGGAGTCTGGACACCATGAATGAACACGCTGTTCAAAATGATTG...

CDS

Download CDS FASTA

843 bp · TkA04G012130|TK1151|CDS

ATGAATGAACACGCTGTTCAAAATGATTGTGATTTACAGCTGTCTTCATCTACTTTACAAGGAAATTTCAACTATGCACCCAATTTACCTGAAACCACTTTCTACCAGCACGTAACCAAAGCAGAAGATCATGATACCTACTCTGTTCCTCAATACGTTGGATTCCAGCAAATGGCTCCATACTATGTTGAGTATCTTGTAGGAAATGGGATCTCTAACATGCAAGAAGAAATACCATATGACAGTACTGGAATCAGATG...

Protein

Download Protein FASTA

280 aa · TkA04G012130|TK1151|PROTEIN

MNEHAVQNDCDLQLSSSTLQGNFNYAPNLPETTFYQHVTKAEDHDTYSVPQYVGFQQMAPYYVEYLVGNGISNMQEEIPYDSTGIRCSLTSDDSYLNMDSHQERHSRHQHEEILANNSRNTQHHICYQKQKSEEGPAKHQLNMSASTSGINKSRRTYLRQKATDTDRRRRTRIAAALDALEDLLPKSNEGNKANIVDDCIDYIKYLQLHMKELSQNRLTPSEPTSNHLAYLEGYGHYIIHENMASGPLQDMAGKLLETSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G012130`
TK1151 ID	TkA04G012130
OH-1004 ID	LXL04_036991
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G012130

Location Chr04:2990138-2992521 (-)

Description Similar to LRL2: Transcription factor LRL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30980`	Transcription factor that regulates the development of root hairs.	Conservation of lotus and Arabidopsis basic helix-loop-helix proteins reveals new players in root hair development.2009 · DOI: 10.1104/pp.109.143867
`At2g24260`	Transcription factor that regulates the development of root hairs.	Conservation of lotus and Arabidopsis basic helix-loop-helix proteins reveals new players in root hair development.2009 · DOI: 10.1104/pp.109.143867
`At5g58010`	Transcription factor that regulates the development of root hairs.	Conservation of lotus and Arabidopsis basic helix-loop-helix proteins reveals new players in root hair development.2009 · DOI: 10.1104/pp.109.143867
`At4g02590`	Required for ovule fertilization.	No verified direct reference in this release
`At1g03040`	Transcription factor bHLH7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036991 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007165 signal transduction Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009704 de-etiolation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

KEGG gene cross-reference

ath:AT1G09530

ath:AT2G24260

ath:AT4G30980

ath:AT5G58010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · TkA04G012130 · TK1151

Cytoplasm0.126

Rank 2 · TkA04G012130 · TK1151

Cell membrane0.027

Rank 3 · TkA04G012130 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA04G012130 · TK1151

Plastid0.011

Rank 5 · TkA04G012130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010HLH159-207 aa

PF23173bHLH_SAC51166-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G012130	`PF00010`	HLH	159	207	3.3e-08	33.9
TkA04G012130	`PF23173`	bHLH_SAC51	166	208	0.0042	17.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S3D5`	Arabidopsis thaliana	sp\|Q8S3D5\|LRL2_ARATH Transcription factor LRL2	34.100%	Swiss-Prot	Low
`Q9ZUG9`	Arabidopsis thaliana	sp\|Q9ZUG9\|LRL1_ARATH Transcription factor LRL1	33.600%	Swiss-Prot	Low
`Q9LSQ3`	Arabidopsis thaliana	sp\|Q9LSQ3\|LRL3_ARATH Transcription factor LRL3	31.200%	Swiss-Prot	Low
`O22768`	Arabidopsis thaliana	sp\|O22768\|UNE12_ARATH Transcription factor UNE12	32.600%	Swiss-Prot	Low
`Q93Y00`	Arabidopsis thaliana	sp\|Q93Y00\|BH007_ARATH Transcription factor bHLH7	31.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card