LXL04_036991 | RubberDandelionOmics

Gene overview

LXL04_036991

Reference: OH-1004 Chr: Chr08 Coordinates: 51290479-51292181 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

843 bp · LXL04_036991|LXL04_036991|OH1004|cDNA

ATGAATGAACACGCTGTTCAAAATGATTGTGATTTACAGCTGTCTTCATCTACTTTACAAGGAAATTTCAACTATGCACCCAATTTACCTGAAACCACTTTCTACCAGCACGTAACCAAAGCAGAAGATCATGATACCTACTCTGTTCCTCAATACGTTGGATTCCAGCAAATGGCTCCATACTATGTTGAGTATCTTGTAGGAAATGGGATCTCTAACATGCAAGAAGAAATACCATATGACAGTACTGGAATCAGATG...

CDS

Download CDS FASTA

843 bp · LXL04_036991|LXL04_036991|OH1004|CDS

ATGAATGAACACGCTGTTCAAAATGATTGTGATTTACAGCTGTCTTCATCTACTTTACAAGGAAATTTCAACTATGCACCCAATTTACCTGAAACCACTTTCTACCAGCACGTAACCAAAGCAGAAGATCATGATACCTACTCTGTTCCTCAATACGTTGGATTCCAGCAAATGGCTCCATACTATGTTGAGTATCTTGTAGGAAATGGGATCTCTAACATGCAAGAAGAAATACCATATGACAGTACTGGAATCAGATG...

Protein

Download Protein FASTA

280 aa · LXL04_036991|LXL04_036991|OH1004|PROTEIN

MNEHAVQNDCDLQLSSSTLQGNFNYAPNLPETTFYQHVTKAEDHDTYSVPQYVGFQQMAPYYVEYLVGNGISNMQEEIPYDSTGIRCSLTSDDSYLNMDSHQERHSRHQHEEILANNSRNTQHHICYQKQKSEEGPAKHQLNMSASTSGINKSRKTYLRQKATDTDRRRRTRIAAALDALEDLLPKSNEGNKANIVDDCIDYIKYLQLHMKELSQNRLTPSEPTSNHLAYLEGYGHYIIHENMASGPLQDMAGKLLETSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036991`
TK1151 ID	TkA04G012130
OH-1004 ID	LXL04_036991
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036991

Location Chr08:51290479-51292181 (+)

Description Similar to LRL2: Transcription factor LRL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30980`	Transcription factor that regulates the development of root hairs.	Conservation of lotus and Arabidopsis basic helix-loop-helix proteins reveals new players in root hair development.2009 · DOI: 10.1104/pp.109.143867
`At2g24260`	Transcription factor that regulates the development of root hairs.	Conservation of lotus and Arabidopsis basic helix-loop-helix proteins reveals new players in root hair development.2009 · DOI: 10.1104/pp.109.143867
`At5g58010`	Transcription factor that regulates the development of root hairs.	Conservation of lotus and Arabidopsis basic helix-loop-helix proteins reveals new players in root hair development.2009 · DOI: 10.1104/pp.109.143867
`At1g09530`	Transcription factor acting in the phytochrome signaling pathway.	PHYTOCHROME INTERACTING FACTOR3 associates with the histone deacetylase HDA15 in repression of chlorophyll biosynthesis and photosynthesis in etiolated Arabidopsis seedlings.2013 · DOI: 10.1105/tpc.113.109710 Coordinated Regulation of Hypocotyl Cell Elongation by Light and Ethylene through a Microtubule Destabilizing Protein.2018 · DOI: 10.1104/pp.17.01109 Submergence stress-induced hypocotyl elongation through ethylene signaling-mediated regulation of cortical microtubules in Arabidopsis.2020 · DOI: 10.1093/jxb/erz453 PHYTOCHROME INTERACTING FACTOR8 Inhibits Phytochrome A-Mediated Far-Red Light Responses in Arabidopsis.2020 · DOI: 10.1105/tpc.19.00515

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036991 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007165 signal transduction Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009704 de-etiolation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

KEGG gene cross-reference

ath:AT1G09530

ath:AT2G24260

ath:AT4G30980

ath:AT5G58010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · LXL04_036991 · OH-1004

Cytoplasm0.125

Rank 2 · LXL04_036991 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_036991 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_036991 · OH-1004

Plastid0.010

Rank 5 · LXL04_036991 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010.32HLH159-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036991	`PF00010.32`	HLH	159	207	3.3e-08	33.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S3D5`	Arabidopsis thaliana	Transcription factor LRL2	34.437%	Swiss-Prot	weak database homology
`Q9ZUG9`	Arabidopsis thaliana	Transcription factor LRL1	33.582%	Swiss-Prot	weak database homology
`Q9LSQ3`	Arabidopsis thaliana	Transcription factor LRL3	31.081%	Swiss-Prot	weak database homology
`O80536`	Arabidopsis thaliana	Transcription factor PIF3	30.328%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card