TkA04G011320 | RubberDandelionOmics

Gene overview

TkA04G011320

Reference: TK1151 Chr: Chr04 Coordinates: 2745887-2757822 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

7891 bp · TkA04G011320|TK1151|cDNA

GGCATTTATAACTTGAACACGAAAAAATGGTACACGCAATCACAGGTGTAACCATCAGCTTCTCCTATAATTACCTTGCCCGCCGGCTACCGTCACGGTGGACACTGCTCATTTTCATCTTGGCCCCATCAATGTGAGCCGTCACACTATGAGACCTTCTTCATTCAGTTGACTGTGTAGTAATCGGAGAGAATTCCTCCTTAAAAGTTTTTCGAGAAGCGAGAAAAAAATCCTAGGGTTAGTAGTTAGTACTGAGTAGA...

CDS

Download CDS FASTA

3933 bp · TkA04G011320|TK1151|CDS

ATGGCGGTGACAGTACCGGCGAGCACGAACACGTGGGATGGAGTGATAGAAATGACAAAATCTGCTCAAAGTAAAGGTGCTGACCCCTTGATGTGGGCAGTTGAGCTCTCTTCTTCGCTCTTGTCTGCAGGAGTATCCATGCCGTCAACTAAGGTAGCCGAATTACTTGTTTCTCACATATGTTGGTCCAATAACGTTCCAATTGCTTGGAAGTTTCTCGAGAAAGCGCTCTCCATTAGAATCGTTCCGCCAATGCTCGT...

Protein

Download Protein FASTA

1310 aa · TkA04G011320|TK1151|PROTEIN

MAVTVPASTNTWDGVIEMTKSAQSKGADPLMWAVELSSSLLSAGVSMPSTKVAELLVSHICWSNNVPIAWKFLEKALSIRIVPPMLVLALLSNRVIPSRRSHPAAYRLYLVLLKRHIFPLPSEVTGPNYHKIMESIDDALHLYQNFGLQSSEPGLVLVEFIFSVVWQLLDASLDDENLLELVPEKKSIWPIKSHEMEIDDFGEKKSDSHQGLYITNTTMAIEIIGELFRNKVTSRILHLARQNMSQHWTSFIHHMRLLVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G011320`
TK1151 ID	TkA04G011320
OH-1004 ID	LXL04_037000
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G011320

Location Chr04:2745887-2757822 (+)

Description Similar to MED33A: Mediator of RNA polymerase II transcription subunit 33A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23590`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	REF4 and RFR1, subunits of the transcriptional coregulatory complex mediator, are required for phenylpropanoid homeostasis in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.312298
`At2g48110`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	Semidominant mutations in reduced epidermal fluorescence 4 reduce phenylpropanoid content in Arabidopsis.2008 · DOI: 10.1534/genetics.107.083881 REF4 and RFR1, subunits of the transcriptional coregulatory complex mediator, are required for phenylpropanoid homeostasis in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.312298

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037000 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

GO:0016020 membrane Cellular Component

GO:0016592 mediator complex Cellular Component

KEGG gene cross-reference

ath:AT2G48110

ath:AT3G23590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.750

Rank 1 · TkA04G011320 · TK1151

Cytoplasm0.299

Rank 2 · TkA04G011320 · TK1151

Mitochondrion0.038

Rank 3 · TkA04G011320 · TK1151

Cell membrane0.033

Rank 4 · TkA04G011320 · TK1151

Golgi apparatus0.027

Rank 5 · TkA04G011320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27814MED33_TPR-like_2nd105-283 aa

PF27774MED33_TPR-like_mid791-1027 aa

PF27769MED33_C1085-1266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G011320	`PF27814`	MED33_TPR-like_2nd	105	283	5e-75	252.0
TkA04G011320	`PF27774`	MED33_TPR-like_mid	791	1027	7.9e-112	373.0
TkA04G011320	`PF27769`	MED33_C	1085	1266	7.5e-79	264.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUG9`	Arabidopsis thaliana	sp\|Q9LUG9\|MD33A_ARATH Mediator of RNA polymerase II transcription subunit 33A	54.800%	Swiss-Prot	High
`F4IN69`	Arabidopsis thaliana	sp\|F4IN69\|MD33B_ARATH Mediator of RNA polymerase II transcription subunit 33B	53.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card