RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G007510
Reference: TK1151 Chr: Chr04 Coordinates: 1802525-1808930 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

5523 bp · TkA04G007510|TK1151|cDNA

ACATACATATAAGTTGTTATTGTTATGTCCACATATAGATTAACAACACATGTGATATGTACGAATTAGGTTGGATCAATCTACTGAATTATCCTAAAATATTTGGTTGAGTAACCTATATCCAAAATCATAGTAATCCTCTTATAAAGTTACAAGTAAAGTAGTAAGCTTACATGGAACAACAACTTTGAGATCATTCTAGATATCAAATTCATATTGTATATTTCTTAAATAAAGTTGATCTAGAAAGTTATCTTTCC...

CDS

Download CDS FASTA

2598 bp · TkA04G007510|TK1151|CDS

ATGGAAGGTTATCGACGGAAGCTCTTGGTTACTTCAAGCAATATCATTCGTTACAATCGCTGTTTTACAATCCACGAGAAGAAATTTCAAGCAGGAACTCACCCAGTCTCTCTTCGAATATTCTGGGTGCTAAATTTCATCGCCATAGCACTAATCACGTATTCCAGTATCGTTCGTCTGGTTTCCAACACTCCATTTTCGAAAAACATCGACTTAATTGCATCAATCTCGTTACCATTTTCAGCTTTCTTCTTGATTCA...

Protein

Download Protein FASTA

865 aa · TkA04G007510|TK1151|PROTEIN

MEGYRRKLLVTSSNIIRYNRCFTIHEKKFQAGTHPVSLRIFWVLNFIAIALITYSSIVRLVSNTPFSKNIDLIASISLPFSAFFLIQSVTGSTGVTVTTESEANELTKSSNVSGWASASILSKTFWLWLNPLLKKGYKTPLTLDDIPSLSPEHRAATMSTRFEENWPGPEEKSKHPVRTTLLRCFWKDITFTGFLAIVKLCVAYVGPLLIKRFVDFTSGKQNSPFEGYYLVLILLSAKFIEVLSSHHFNFHSQKLGMSIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G007510
TK1151 IDTkA04G007510
OH-1004 IDLXL04_037054
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.500
Protein coverage (%)TK1151 95.145 / OH-1004 55.013
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G007510
LocationChr04:1802525-1808930 (+)
DescriptionSimilar to ABCC14: ABC transporter C family member 14
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g62700 Pump for glutathione S-conjugates. No verified direct reference in this release
At2g47800 Involved in the regulation of stomatal aperture. No verified direct reference in this release
At1g04120 Pump for glutathione S-conjugates.
The Arabidopsis thaliana ABC transporter AtMRP5 controls root development and stomata movement.2001 · DOI: 10.1093/emboj/20.8.1875
The plant multidrug resistance ABC transporter AtMRP5 is involved in guard cell hormonal signalling and water use.2003 · DOI: 10.1046/j.1365-313x.2003.016012.x
Binding of sulfonylurea by AtMRP5, an Arabidopsis multidrug resistance-related protein that functions in salt tolerance.2004 · DOI: 10.1104/pp.103.027045
The Arabidopsis ATP-binding cassette protein AtMRP5/AtABCC5 is a high affinity inositol hexakisphosphate transporter involved in guard cell signaling and phytate storage.2009 · DOI: 10.1074/jbc.m109.030247

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XCD4 ABC transporter that may affect phytic acid transport and compartmentalization. No verified direct reference in this release
Os03g0142800 ABC transporter that may affect phytic acid transport and compartmentalization.
Mutations of the multi-drug resistance-associated protein ABC transporter gene 5 result in reduction of phytic acid in rice seeds.2009 · DOI: 10.1007/s00122-009-1018-1
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037054 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009414 response to water deprivation Biological Process
GO:0009611 response to wounding Biological Process
GO:0009624 response to nematode Biological Process
GO:0009651 response to salt stress Biological Process
GO:0010118 stomatal movement Biological Process
GO:0030007 intracellular potassium ion homeostasis Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005829 cytosol Cellular Component
KEGG gene cross-reference
ath:AT1G04120
ath:AT2G47800
ath:AT3G62700
dosa:Os03g0142800
zma:100125659
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.315
Rank 1 · TkA04G007510 · TK1151
Lysosome / Vacuole0.310
Rank 2 · TkA04G007510 · TK1151
Endoplasmic reticulum0.190
Rank 3 · TkA04G007510 · TK1151
Cytoplasm0.141
Rank 4 · TkA04G007510 · TK1151
Golgi apparatus0.117
Rank 5 · TkA04G007510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03653UPF009315-53 aa
PF06745ATPase80-123 aa
PF00664ABC_membrane191-457 aa
PF03653UPF0093289-378 aa
PF02463SMC_N350-374 aa
PF03193RsgA_GTPase528-565 aa
PF20703nSTAND1529-567 aa
PF00005ABC_tran530-662 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G007510PF03653UPF009315530.8510.4
TkA04G007510PF06745ATPase801230.0513.7
TkA04G007510PF00664ABC_membrane1914571.2e-31111.1
TkA04G007510PF03653UPF00932893780.8510.4
TkA04G007510PF02463SMC_N3503746.7e-0523.1
TkA04G007510PF03193RsgA_GTPase5285650.212.2
TkA04G007510PF20703nSTAND15295670.09113.1
TkA04G007510PF00005ABC_tran5306621.1e-2178.6
TkA04G007510PF13555AAA_295345560.06213.8
TkA04G007510PF06745ATPase5365540.0513.7
TkA04G007510PF00931NB-ARC5405950.929.7
TkA04G007510PF02463SMC_N5417046.7e-0523.1
TkA04G007510PF01926MMR_HSR15435690.212.5
TkA04G007510PF11868DUF33886417050.2511.5
TkA04G007510PF03653UPF00938068620.8510.4
TkA04G007510PF00664ABC_membrane8158361.2e-31111.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LZJ5Arabidopsis thalianasp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 1463.100%Swiss-ProtHigh
Q7DM58Arabidopsis thalianasp|Q7DM58|AB4C_ARATH ABC transporter C family member 464.700%Swiss-ProtHigh
Q7GB25Arabidopsis thalianasp|Q7GB25|AB5C_ARATH ABC transporter C family member 540.400%Swiss-ProtMedium
A2XCD4Oryza sativa subsp. indicasp|A2XCD4|AB13C_ORYSI ABC transporter C family member 1339.200%Swiss-ProtMedium
Q10RX7Oryza sativa subsp. japonicasp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 1339.200%Swiss-ProtMedium

JBrowse

View in Genome Browser