TkA03G607240 | RubberDandelionOmics

Gene overview

TkA03G607240

Reference: TK1151 Chr: Chr03 Coordinates: 154223128-154223820 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

693 bp · TkA03G607240|TK1151|cDNA

ATGCTTGTTGTCTACGATTACTCTGCTAACCGTCTCTTAGGTCATCTCCTTTCCCATCACACCAATCGGAAATCACGGGTTCTAAAATGGGACCATCGATACAACATCGTGAAATCACTCGCTTGTGCAATCCGATACCTTCACGAGGAATGGGAAGAACAGGTTATCCACAGAAACATAACTTCTTCTGCCATATACATCGACCCTGACATGAACCCTAGACTCGGATCCTTTGCTCTTGCTGAATTCTTAACAAGAAA...

CDS

Download CDS FASTA

693 bp · TkA03G607240|TK1151|CDS

ATGCTTGTTGTCTACGATTACTCTGCTAACCGTCTCTTAGGTCATCTCCTTTCCCATCACACCAATCGGAAATCACGGGTTCTAAAATGGGACCATCGATACAACATCGTGAAATCACTCGCTTGTGCAATCCGATACCTTCACGAGGAATGGGAAGAACAGGTTATCCACAGAAACATAACTTCTTCTGCCATATACATCGACCCTGACATGAACCCTAGACTCGGATCCTTTGCTCTTGCTGAATTCTTAACAAGAAA...

Protein

Download Protein FASTA

230 aa · TkA03G607240|TK1151|PROTEIN

MLVVYDYSANRLLGHLLSHHTNRKSRVLKWDHRYNIVKSLACAIRYLHEEWEEQVIHRNITSSAIYIDPDMNPRLGSFALAEFLTRNENRHHVVVDKKICVRGIFGYMASEYMEVGEATTMADIYSFDVVVLEVVSGRKVVDFRRPEVLLVKRVHESEGYEGNYEELVDPRLDGKYNRKELVRLVKLAMACTQSNPELRPTMRMVVTVLDGHDRCFTEEGQNESTKFSTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G607240`
TK1151 ID	TkA03G607240
OH-1004 ID	LXL04_011634
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G607240

Location Chr03:154223128-154223820 (-)

Description Similar to LECRKS2: Receptor like protein kinase S.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32800`	Receptor like protein kinase S.2.	No verified direct reference in this release
`At5g59270`	Putative L-type lectin-domain containing receptor kinase II.2.	No verified direct reference in this release
`At5g59260`	Probable L-type lectin-domain containing receptor kinase II.1.	No verified direct reference in this release
`At3g55550`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0640500`	Lectin-domain containing receptor kinase involved in salt stress response.	The Receptor-Like Kinase SIT1 Mediates Salt Sensitivity by Activating MAPK3/6 and Regulating Ethylene Homeostasis in Rice.2014 · DOI: 10.1105/tpc.114.125187 Mutual Regulation of Receptor-Like Kinase SIT1 and B'κ-PP2A Shapes the Early Response of Rice to Salt Stress.2019 · DOI: 10.1105/tpc.18.00706

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011634 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0071395 cellular response to jasmonic acid stimulus Biological Process

GO:0071446 cellular response to salicylic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G32800

ath:AT5G01560

ath:AT5G59260

ath:AT5G59270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.531

Rank 1 · TkA03G607240 · TK1151

Cytoplasm0.395

Rank 2 · TkA03G607240 · TK1151

Nucleus0.257

Rank 3 · TkA03G607240 · TK1151

Endoplasmic reticulum0.033

Rank 4 · TkA03G607240 · TK1151

Golgi apparatus0.031

Rank 5 · TkA03G607240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr2-208 aa

PF00069Pkinase2-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G607240	`PF07714`	PK_Tyr_Ser-Thr	2	208	2.5e-15	57.2
TkA03G607240	`PF00069`	Pkinase	2	206	7.1e-14	52.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48837`	Arabidopsis thaliana	sp\|O48837\|LRKS2_ARATH Receptor like protein kinase S.2	58.000%	Swiss-Prot	High
`Q9FIF0`	Arabidopsis thaliana	sp\|Q9FIF0\|LRK22_ARATH Putative L-type lectin-domain containing receptor kinase II.2	43.500%	Swiss-Prot	Medium
`Q9FIF1`	Arabidopsis thaliana	sp\|Q9FIF1\|LRK21_ARATH Probable L-type lectin-domain containing receptor kinase II.1	42.800%	Swiss-Prot	Medium
`Q9M2S4`	Arabidopsis thaliana	sp\|Q9M2S4\|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4	36.000%	Swiss-Prot	Medium
`Q6H7D2`	Oryza sativa subsp. japonica	sp\|Q6H7D2\|SIT1_ORYSJ L-type lectin-domain containing receptor kinase SIT1	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card