LXL04_011634 | RubberDandelionOmics

Gene overview

LXL04_011634

Reference: OH-1004 Chr: Chr02 Coordinates: 168596206-168596898 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

693 bp · LXL04_011634|LXL04_011634|OH1004|cDNA

ATGCTTGTTGTCTACGATTACTCTGCTAACCGTCTCTTAGGTCATCTCATTTCCCATCACACCAATCGGAAATCACGGGTTCTAAAATGGGACCATCGATACAACATCGTGAAATCACTCGCTTGTGCAATCCGATACCTTCACGAGGAATGGGAAGAACAGGTTATCCACAGAAACATAACTTCTTCTGCCATATACATCGACCCTGACATGAACCCTAGACTCGGATCCTTTGCTCTTGCTGAATTCTTAATAAGAAA...

CDS

Download CDS FASTA

693 bp · LXL04_011634|LXL04_011634|OH1004|CDS

ATGCTTGTTGTCTACGATTACTCTGCTAACCGTCTCTTAGGTCATCTCATTTCCCATCACACCAATCGGAAATCACGGGTTCTAAAATGGGACCATCGATACAACATCGTGAAATCACTCGCTTGTGCAATCCGATACCTTCACGAGGAATGGGAAGAACAGGTTATCCACAGAAACATAACTTCTTCTGCCATATACATCGACCCTGACATGAACCCTAGACTCGGATCCTTTGCTCTTGCTGAATTCTTAATAAGAAA...

Protein

Download Protein FASTA

230 aa · LXL04_011634|LXL04_011634|OH1004|PROTEIN

MLVVYDYSANRLLGHLISHHTNRKSRVLKWDHRYNIVKSLACAIRYLHEEWEEQVIHRNITSSAIYIDPDMNPRLGSFALAEFLIRNENRHHVVVDKKICVRGIFGYMASKYMEVGEATTMAYIYSFGVVVLEVVSGRKVVDFRRPEVLLVKRVHESEGYEGNYEELVDPRLDGKYNRKELVRLVKLAMACTQSNPELRPTMRMVVTVLDGHDRCFTEEGQNESTKFSTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011634`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011634

Location Chr02:168596206-168596898 (-)

Description Similar to LECRKS2: Receptor like protein kinase S.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32800`	Receptor like protein kinase S.2.	No verified direct reference in this release
`At5g59270`	Putative L-type lectin-domain containing receptor kinase II.2.	No verified direct reference in this release
`At5g59260`	Probable L-type lectin-domain containing receptor kinase II.1.	No verified direct reference in this release
`At5g01560`	Involved in negative regulation of abscisic acid response in seed germination.	The Arabidopsis A4 subfamily of lectin receptor kinases negatively regulates abscisic acid response in seed germination.2009 · DOI: 10.1104/pp.108.130583

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0640500`	Lectin-domain containing receptor kinase involved in salt stress response.	The Receptor-Like Kinase SIT1 Mediates Salt Sensitivity by Activating MAPK3/6 and Regulating Ethylene Homeostasis in Rice.2014 · DOI: 10.1105/tpc.114.125187 Mutual Regulation of Receptor-Like Kinase SIT1 and B'κ-PP2A Shapes the Early Response of Rice to Salt Stress.2019 · DOI: 10.1105/tpc.18.00706

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011634 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0071395 cellular response to jasmonic acid stimulus Biological Process

GO:0071446 cellular response to salicylic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G32800

ath:AT5G01560

ath:AT5G59260

ath:AT5G59270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.514

Rank 1 · LXL04_011634 · OH-1004

Cytoplasm0.408

Rank 2 · LXL04_011634 · OH-1004

Nucleus0.255

Rank 3 · LXL04_011634 · OH-1004

Endoplasmic reticulum0.033

Rank 4 · LXL04_011634 · OH-1004

Golgi apparatus0.031

Rank 5 · LXL04_011634 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase2-206 aa

PF07714.24PK_Tyr_Ser-Thr3-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011634	`PF00069.32`	Pkinase	2	206	4.5e-12	46.6
LXL04_011634	`PF07714.24`	PK_Tyr_Ser-Thr	3	208	1.1e-12	48.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48837`	Arabidopsis thaliana	Receptor like protein kinase S.2	57.080%	Swiss-Prot	strong database homology
`Q9FIF0`	Arabidopsis thaliana	Putative L-type lectin-domain containing receptor kinase II.2	43.256%	Swiss-Prot	moderate database homology
`Q9FIF1`	Arabidopsis thaliana	Probable L-type lectin-domain containing receptor kinase II.1	41.860%	Swiss-Prot	moderate database homology
`Q66GN2`	Arabidopsis thaliana	Lectin-domain containing receptor kinase VI.4	37.143%	Swiss-Prot	moderate database homology
`Q6H7D2`	Oryza sativa subsp. japonica	L-type lectin-domain containing receptor kinase SIT1	38.140%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card