TkA03G603000 | RubberDandelionOmics

Gene overview

TkA03G603000

Reference: TK1151 Chr: Chr03 Coordinates: 153182426-153186514 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1389 bp · TkA03G603000|TK1151|cDNA

ATGGACGCTTCATCTGTTAGAAATCTCTGCCGACATTTGATTTCGTCGGCAATTCAACGATGTCGCATATCAGGGGAACTTTGTCGATTATCCGTCGGTTTGAAATCGTCTCCACTTGCCAATCCTCCTTTAGTTCGCATCTCAATTTCTGATACGGGAGTTGGAAGCTGCTTGGAGGAGTTTCTGGATGTGAAGAACCTAAGTGATTCATCATTGAATCAGATACATGATGGAGTTATATCAATTGCTACTACTAAGGC...

CDS

Download CDS FASTA

1389 bp · TkA03G603000|TK1151|CDS

ATGGACGCTTCATCTGTTAGAAATCTCTGCCGACATTTGATTTCGTCGGCAATTCAACGATGTCGCATATCAGGGGAACTTTGTCGATTATCCGTCGGTTTGAAATCGTCTCCACTTGCCAATCCTCCTTTAGTTCGCATCTCAATTTCTGATACGGGAGTTGGAAGCTGCTTGGAGGAGTTTCTGGATGTGAAGAACCTAAGTGATTCATCATTGAATCAGATACATGATGGAGTTATATCAATTGCTACTACTAAGGC...

Protein

Download Protein FASTA

462 aa · TkA03G603000|TK1151|PROTEIN

MDASSVRNLCRHLISSAIQRCRISGELCRLSVGLKSSPLANPPLVRISISDTGVGSCLEEFLDVKNLSDSSLNQIHDGVISIATTKACDNEIFHYNIDLKQKDSTKRLAKLPVTPKNGATFSGTEVSFSTFHSIEALQEDITCFFQKMLIIKIPKVGIELIVDNGEVSEHKCINVIDLPSETDAECLKSGLVDYVVKHGNQKDSICHSCFPIGDHLKVGNGEVCKRYRNTETRIEAVVIISELSEMVDPSCFRACGSKTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G603000`
TK1151 ID	TkA03G603000
OH-1004 ID	LXL04_011584
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G603000

Location Chr03:153182426-153186514 (-)

Description Similar to MTOPVIB: Type 2 DNA topoisomerase 6 subunit B-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60460`	Component of a topoisomerase 6 complex specifically required for meiotic recombination.	A DNA topoisomerase VI-like complex initiates meiotic recombination.2016 · DOI: 10.1126/science.aad5196 MTOPVIB interacts with AtPRD1 and plays important roles in formation of meiotic DNA double-strand breaks in Arabidopsis.2017 · DOI: 10.1038/s41598-017-10270-9

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011584 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0042138 meiotic DNA double-strand break formation Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0048314 embryo sac morphogenesis Biological Process

GO:0065003 protein-containing complex assembly Biological Process

GO:0000793 condensed chromosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity Molecular Function

GO:0030674 protein-macromolecule adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G60460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.720

Rank 1 · TkA03G603000 · TK1151

Cytoplasm0.285

Rank 2 · TkA03G603000 · TK1151

Cell membrane0.052

Rank 3 · TkA03G603000 · TK1151

Mitochondrion0.048

Rank 4 · TkA03G603000 · TK1151

Endoplasmic reticulum0.042

Rank 5 · TkA03G603000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28653MTOPVIB_middle185-351 aa

PF28618MTOPVIB_C359-421 aa

PF29448SWP7384-423 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G603000	`PF28653`	MTOPVIB_middle	185	351	4.2e-61	206.3
TkA03G603000	`PF28618`	MTOPVIB_C	359	421	6.4e-26	90.9
TkA03G603000	`PF29448`	SWP7	384	423	0.047	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5Q0E6`	Arabidopsis thaliana	sp\|Q5Q0E6\|TO6BL_ARATH Type 2 DNA topoisomerase 6 subunit B-like	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card