TkA03G602400 | RubberDandelionOmics

Gene overview

TkA03G602400

Reference: TK1151 Chr: Chr03 Coordinates: 152999038-153003027 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1201 bp · TkA03G602400|TK1151|cDNA

CTTTAATGTGCCAACAACCTACAAAAACATATATATAAACCAAAAACATGTCATTCAAGAATCAGTGAATTCTCTGCAACACCTGAAAATGACATTTTTGCCACAAAGGTTTCTTCTATCATGTCTTGTTATCTCTAGCAATTATTTACTGTTTCCGGTTTTATCTCGAGGGATCGTTCATAAACCCCCGAATGTTGAGAAGTTAACAGATCGTTTTCTTCCAACACCTATTGCCGGAAAGATGCTGACTTTTTTTGGAG...

CDS

Download CDS FASTA

954 bp · TkA03G602400|TK1151|CDS

ATGACATTTTTGCCACAAAGGTTTCTTCTATCATGTCTTGTTATCTCTAGCAATTATTTACTGTTTCCGGTTTTATCTCGAGGGATCGTTCATAAACCCCCGAATGTTGAGAAGTTAACAGATCGTTTTCTTCCAACACCTATTGCCGGAAAGATGCTGACTTTTTTTGGAGCACCGAATATTCGTATGAAAAGCAATGGGTCATATGCTGATATCATCCTAGACACAACTTCAGGTTCTGGATTGGTTTCAAAACAAAA...

Protein

Download Protein FASTA

317 aa · TkA03G602400|TK1151|PROTEIN

MTFLPQRFLLSCLVISSNYLLFPVLSRGIVHKPPNVEKLTDRFLPTPIAGKMLTFFGAPNIRMKSNGSYADIILDTTSGSGLVSKQKYFHGFFSAAIRLPMGITSGVVLAFYMSNSDVCPHNHDEIDFELLGHENRKEWVLQTNIYGNGNVKIGREEKFYLWFDPTQDFHQYSILWNTHHIIYLVDNIPIREVINNQASSSVYPLKPMSLYVTIWDGSEWATHGGKYPVNYQYAPFVASLGELEVDGGLTQPTNASTIGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G602400`
TK1151 ID	TkA03G602400
OH-1004 ID	LXL04_011567
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.054 / OH-1004 28.314 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G602400

Location Chr03:152999038-153003027 (-)

Description Similar to XTH33: Probable xyloglucan endotransglucosylase/hydrolase protein 33

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10550`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At1g14720`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At2g01850`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	AtXTH27 plays an essential role in cell wall modification during the development of tracheary elements.2005 · DOI: 10.1111/j.1365-313x.2005.02395.x
`At1g32170`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At4g18990`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011567 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010154 fruit development Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080086 stamen filament development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function

GO:0016762 xyloglucan:xyloglucosyl transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10550

ath:AT1G14720

ath:AT1G32170

ath:AT2G01850

ath:AT4G18990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.299

Rank 1 · TkA03G602400 · TK1151

Extracellular0.213

Rank 2 · TkA03G602400 · TK1151

Endoplasmic reticulum0.154

Rank 3 · TkA03G602400 · TK1151

Cell membrane0.145

Rank 4 · TkA03G602400 · TK1151

Golgi apparatus0.144

Rank 5 · TkA03G602400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00722Glyco_hydro_1664-232 aa

PF09939DUF2171261-285 aa

PF06955XET_C279-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G602400	`PF00722`	Glyco_hydro_16	64	232	8.1e-53	179.2
TkA03G602400	`PF09939`	DUF2171	261	285	0.23	12.5
TkA03G602400	`PF06955`	XET_C	279	315	1.7e-11	44.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LC45`	Arabidopsis thaliana	sp\|Q8LC45\|XTH33_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 33	55.500%	Swiss-Prot	High
`Q38909`	Arabidopsis thaliana	sp\|Q38909\|XTH28_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 28	50.800%	Swiss-Prot	High
`Q8LDS2`	Arabidopsis thaliana	sp\|Q8LDS2\|XTH27_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 27	50.400%	Swiss-Prot	High
`Q38908`	Arabidopsis thaliana	sp\|Q38908\|XTH30_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 30	47.300%	Swiss-Prot	Medium
`Q8L7H3`	Arabidopsis thaliana	sp\|Q8L7H3\|XTH29_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 29	44.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card