LXL04_011567 | RubberDandelionOmics

Gene overview

LXL04_011567

Reference: OH-1004 Chr: Chr02 Coordinates: 167436345-167445900 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3330 bp · LXL04_011567|LXL04_011567|OH1004|cDNA

ATGACATTTTTGCCACAAAGGTTTCTTCTATCATGTCTTGTTATCTCTAGCAATTATTTACTGTTTCCGGTTTTATCTCGAGGGATCGTTCATAAACCCCCGAATGTTGAGAAGTTAACAGATCGTTTTCTTCCAACACCTATTGCCGGAAAGATGCTGACTTTTTTTGGAGCACCGAATATTCGTATGAAAAGCAATGGGTCATATGCTGATATCATCCTAGACACAACTTCAGGTTCTGGATTGGTTTCAAAACAAAA...

CDS

Download CDS FASTA

3330 bp · LXL04_011567|LXL04_011567|OH1004|CDS

ATGACATTTTTGCCACAAAGGTTTCTTCTATCATGTCTTGTTATCTCTAGCAATTATTTACTGTTTCCGGTTTTATCTCGAGGGATCGTTCATAAACCCCCGAATGTTGAGAAGTTAACAGATCGTTTTCTTCCAACACCTATTGCCGGAAAGATGCTGACTTTTTTTGGAGCACCGAATATTCGTATGAAAAGCAATGGGTCATATGCTGATATCATCCTAGACACAACTTCAGGTTCTGGATTGGTTTCAAAACAAAA...

Protein

Download Protein FASTA

1109 aa · LXL04_011567|LXL04_011567|OH1004|PROTEIN

MTFLPQRFLLSCLVISSNYLLFPVLSRGIVHKPPNVEKLTDRFLPTPIAGKMLTFFGAPNIRMKSNGSYADIILDTTSGSGLVSKQKYFHGFFSAAIRLPMGITSGVVLAFYMSNSDVCPHNHDEIDFELLGHENRKEWVLQTNIYGNGNVKIGREEKFYLWFDPTQDFHQYSILWNTHHIIYLVDNIPIREVINNQASSSVYPLKPMSLYVTIWDGSEWATHGGKYPVNYQYAPFVASLGELEVDGGLTQPTNASTIGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011567`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011567

Location Chr02:167436345-167445900 (-)

Description Similar to XTH33: Probable xyloglucan endotransglucosylase/hydrolase protein 33

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10550`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At1g14720`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At2g01850`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	AtXTH27 plays an essential role in cell wall modification during the development of tracheary elements.2005 · DOI: 10.1111/j.1365-313x.2005.02395.x
`At1g32170`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At4g18990`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011567 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010154 fruit development Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080086 stamen filament development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function

GO:0016762 xyloglucan:xyloglucosyl transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10550

ath:AT1G14720

ath:AT1G32170

ath:AT2G01850

ath:AT4G18990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.331

Rank 1 · LXL04_011567 · OH-1004

Cytoplasm0.230

Rank 2 · LXL04_011567 · OH-1004

Endoplasmic reticulum0.173

Rank 3 · LXL04_011567 · OH-1004

Cell membrane0.125

Rank 4 · LXL04_011567 · OH-1004

Extracellular0.083

Rank 5 · LXL04_011567 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00722.29Glyco_hydro_1664-232 aa

PF06955.20XET_C279-314 aa

PF03108.21DBD_Tnp_Mut668-730 aa

PF10551.16MULE863-959 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011567	`PF00722.29`	Glyco_hydro_16	64	232	8.3e-52	175.9
LXL04_011567	`PF06955.20`	XET_C	279	314	3e-09	37.2
LXL04_011567	`PF03108.21`	DBD_Tnp_Mut	668	730	4.5e-10	39.8
LXL04_011567	`PF10551.16`	MULE	863	959	5e-14	53.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LC45`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 33	55.319%	Swiss-Prot	weak database homology
`Q38909`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 28	48.276%	Swiss-Prot	weak database homology
`Q8LDS2`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 27	47.423%	Swiss-Prot	weak database homology
`Q38908`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 30	45.818%	Swiss-Prot	weak database homology
`Q8L7H3`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 29	43.019%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card