TkA03G596470 | RubberDandelionOmics

Gene overview

TkA03G596470

Reference: TK1151 Chr: Chr03 Coordinates: 151463797-151466665 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1596 bp · TkA03G596470|TK1151|cDNA

CAATAACAAAAGACGTCAACAGGACCATCTCTACACCCTTGCTCTCTTCTCCCGTTTTCTTCTCCGGTACACGCACAAACACATTCAACTGTGTGTTAATATATACACACAGCTTTTTTTTTCACATGTATAGCCTATAGATACATACAACCAGCTCTCTCTAAATTCTATCTACAGGTTTGTAGATTCAGCATCCGCATTCAATTACAGAGTTTGTGGTTTGATAACACACAGAATCACAGAGACAGACATACGTATGT...

CDS

Download CDS FASTA

765 bp · TkA03G596470|TK1151|CDS

ATGAGATTTCGGGGTGATCGTGTGTACAAATCTTTTCTTGCTATTTTGAATATGTACAGAAAGGAAAACAAACCAATTAAAGAGGTCCACCAAGAGGTTGCTGCTCTTCTTCATAACCAGCCAGACCTTCTGAATGAGTTCACCAATTTCTTACCTGATTCTGAAACACCAGCTTCCAATCAGTATATTCATTCCAGTAGGGCCCACAAACCTCGCCCTGAAGATAGAAGCTCGCCAGCTGGCAGAATAAGACCTCCACC...

Protein

Download Protein FASTA

254 aa · TkA03G596470|TK1151|PROTEIN

MRFRGDRVYKSFLAILNMYRKENKPIKEVHQEVAALLHNQPDLLNEFTNFLPDSETPASNQYIHSSRAHKPRPEDRSSPAGRIRPPPSEKKGEVSADMAIIIMRKNMLEVRRSIRGMVIEKKVKREEIEQHHSQDRDSNRVNHKRKSTNALEDSVSELFHQDMRDQVICLREKVKERLHNSDDYQSFLKCIVHYCTENINRPQLQSLVNNLLGAHPDLMEEVNGFIDRSERTGNQLIINKKTYSNLHTKNLINF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G596470`
TK1151 ID	TkA03G596470
OH-1004 ID	LXL04_011516
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.400
Protein coverage (%)	TK1151 92.520 / OH-1004 21.922 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G596470

Location Chr03:151463797-151466665 (-)

Description Similar to SNL3: Paired amphipathic helix protein Sin3-like 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15020`	Acts as a transcriptional repressor.	No verified direct reference in this release
`At3g01320`	Acts as a transcriptional repressor.	PAH-domain-specific interactions of the Arabidopsis transcription coregulator SIN3-LIKE1 (SNL1) with telomere-binding protein 1 and ALWAYS EARLY2 Myb-DNA binding factors.2010 · DOI: 10.1016/j.jmb.2009.11.065
`At1g24190`	Acts as a transcriptional repressor.	Role of an Arabidopsis AP2/EREBP-type transcriptional repressor in abscisic acid and drought stress responses.2005 · DOI: 10.1105/tpc.105.033043
`At1g70060`	Acts as a transcriptional repressor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011516 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0000118 histone deacetylase complex Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0070822 Sin3-type complex Cellular Component

GO:0003714 transcription corepressor activity Molecular Function

KEGG gene cross-reference

ath:AT1G24190

ath:AT1G70060

ath:AT3G01320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.685

Rank 1 · TkA03G596470 · TK1151

Cytoplasm0.312

Rank 2 · TkA03G596470 · TK1151

Cell membrane0.080

Rank 3 · TkA03G596470 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA03G596470 · TK1151

Lysosome / Vacuole0.022

Rank 5 · TkA03G596470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02671PAH8-51 aa

PF23202PAH_ZNF5989-55 aa

PF05205COMPASS-Shg122-42 aa

PF05205COMPASS-Shg1104-147 aa

PF02671PAH143-160 aa

PF10212PPP1R21_helical148-215 aa

PF23202PAH_ZNF598149-162 aa

PF23202PAH_ZNF598170-225 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G596470	`PF02671`	PAH	8	51	9.7e-29	99.6
TkA03G596470	`PF23202`	PAH_ZNF598	9	55	6.1e-05	23.9
TkA03G596470	`PF05205`	COMPASS-Shg1	22	42	0.42	12.1
TkA03G596470	`PF05205`	COMPASS-Shg1	104	147	0.42	12.1
TkA03G596470	`PF02671`	PAH	143	160	9.7e-29	99.6
TkA03G596470	`PF10212`	PPP1R21_helical	148	215	0.047	14.2
TkA03G596470	`PF23202`	PAH_ZNF598	149	162	6.1e-05	23.9
TkA03G596470	`PF23202`	PAH_ZNF598	170	225	6.1e-05	23.9
TkA03G596470	`PF05205`	COMPASS-Shg1	170	223	0.42	12.1
TkA03G596470	`PF02671`	PAH	183	225	9.7e-29	99.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFQ3`	Arabidopsis thaliana	sp\|Q9LFQ3\|SNL2_ARATH Paired amphipathic helix protein Sin3-like 2	37.800%	Swiss-Prot	Medium
`Q9SRH9`	Arabidopsis thaliana	sp\|Q9SRH9\|SNL1_ARATH Paired amphipathic helix protein Sin3-like 1	37.300%	Swiss-Prot	Medium
`O48686`	Arabidopsis thaliana	sp\|O48686\|SNL3_ARATH Paired amphipathic helix protein Sin3-like 3	35.400%	Swiss-Prot	Medium
`O04539`	Arabidopsis thaliana	sp\|O04539\|SNL4_ARATH Paired amphipathic helix protein Sin3-like 4	33.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card