TkA03G592990 | RubberDandelionOmics

Gene overview

TkA03G592990

Reference: TK1151 Chr: Chr03 Coordinates: 150582338-150585192 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2416 bp · TkA03G592990|TK1151|cDNA

ATATAAAGATTGCCAAAACACGTGTCAAGACCGGCTATCGCCGGTTACCGGTCATCTCCTCGACCCCTTAAGAACAGTCGAACTCGGCGGCGACTCGACGCAAAGTTAGAAAAAAACCCAGCTGGTTGTGGGTCCCATACGCCACCGTCGACCGCCGTCCTCCTCTTTCTCCTTCATCCTCCCTCCCTCCCTCCCTCCCTCCCTTCCTTCCTTCCTCTCTCTTTTCTCCCTCTGTCTCTCTCTAGCTATATATAGATATG...

CDS

Download CDS FASTA

1320 bp · TkA03G592990|TK1151|CDS

ATGTTGGAGGATCGATCCTTTTTGGTTTCAAGAACCTTCAACACCAAAAGCAACACCACGTGGGGTTTTATGAGTAACTTCCCAATCAAAACCATTCAAGAAAAACGTCCTTTAGAACTCGAAGAAGACGAAGAACAACCAATTCCCGCAAGAAAAATCTCCAAATACCAAAACCTCGAACTCGGATTAGGGTTCCTCGACCTCGCAATCGACCAATCCCGTGATTCCGATTCCAACTCCAATTCCAATTCGGATTCCGA...

Protein

Download Protein FASTA

439 aa · TkA03G592990|TK1151|PROTEIN

MLEDRSFLVSRTFNTKSNTTWGFMSNFPIKTIQEKRPLELEEDEEQPIPARKISKYQNLELGLGFLDLAIDQSRDSDSNSNSNSDSDSDSTSLIHAIGRDNSISCLLRCSRSDYGALASLNRTFRDLISTGELYRLRRKNNIIEHWVYFSCHLVQWEAFDPINQRWMHLPTMSSNTCFQFSDKESLAVGTELLVLGKEVMDHVIYKYSLLTNSWSFGQLMNLPRCLFGSASLGEIAIVAGGSDPNGKIMNSAELYNSESG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G592990`
TK1151 ID	TkA03G592990
OH-1004 ID	LXL04_011487
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G592990

Location Chr03:150582338-150585192 (-)

Description Similar to SKIP11: F-box/kelch-repeat protein SKIP11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26930`	F-box/kelch-repeat protein At1g26930.	No verified direct reference in this release
`At2g02870`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g74510`	F-box/kelch-repeat protein At1g74510.	No verified direct reference in this release
`At5g60570`	F-box/kelch-repeat protein At5g60570.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011487 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G26930

ath:AT1G74510

ath:AT2G02870

ath:AT3G27150

ath:AT5G60570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.766

Rank 1 · TkA03G592990 · TK1151

Cytoplasm0.227

Rank 2 · TkA03G592990 · TK1151

Cell membrane0.056

Rank 3 · TkA03G592990 · TK1151

Plastid0.039

Rank 4 · TkA03G592990 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA03G592990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15370NOPCHAP141-90 aa

PF05110AF-472-91 aa

PF00646F-box104-135 aa

PF24981Beta-prop_ATRN-LZTR1141-294 aa

PF25210Kelch_FKB95156-207 aa

PF01344Kelch_1157-173 aa

PF24681Kelch_KLHDC2_KLHL20_DRC7157-196 aa

PF24996NANM157-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G592990	`PF15370`	NOPCHAP1	41	90	0.11	13.7
TkA03G592990	`PF05110`	AF-4	72	91	0.63	9.9
TkA03G592990	`PF00646`	F-box	104	135	0.21	12.3
TkA03G592990	`PF24981`	Beta-prop_ATRN-LZTR1	141	294	7.3e-08	32.7
TkA03G592990	`PF25210`	Kelch_FKB95	156	207	4.2e-13	50.2
TkA03G592990	`PF01344`	Kelch_1	157	173	2e-24	85.5
TkA03G592990	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	157	196	7.1e-07	29.5
TkA03G592990	`PF24996`	NANM	157	175	0.00018	21.2
TkA03G592990	`PF01344`	Kelch_1	201	217	2e-24	85.5
TkA03G592990	`PF13964`	Beta-prop_Calicin	201	216	3.1e-09	37.0
TkA03G592990	`PF13415`	Beta-prop_FBX42	202	292	5.7e-05	23.6
TkA03G592990	`PF07646`	Kelch_2	204	217	1.5e-08	34.9
TkA03G592990	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	204	328	7.1e-07	29.5
TkA03G592990	`PF01344`	Kelch_1	223	268	2e-24	85.5
TkA03G592990	`PF07646`	Kelch_2	223	268	1.5e-08	34.9
TkA03G592990	`PF13964`	Beta-prop_Calicin	234	378	3.1e-09	37.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84M94`	Arabidopsis thaliana	sp\|Q84M94\|FBK15_ARATH F-box/kelch-repeat protein At1g26930	63.400%	Swiss-Prot	High
`Q8L736`	Arabidopsis thaliana	sp\|Q8L736\|SKI11_ARATH F-box/kelch-repeat protein SKIP11	65.300%	Swiss-Prot	High
`Q9CA63`	Arabidopsis thaliana	sp\|Q9CA63\|FBK29_ARATH F-box/kelch-repeat protein At1g74510	57.100%	Swiss-Prot	High
`Q9FKJ0`	Arabidopsis thaliana	sp\|Q9FKJ0\|FK132_ARATH F-box/kelch-repeat protein At5g60570	39.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card