LXL04_011487 | RubberDandelionOmics

Gene overview

LXL04_011487

Reference: OH-1004 Chr: Chr02 Coordinates: 165341583-165342902 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1320 bp · LXL04_011487|LXL04_011487|OH1004|cDNA

ATGTTGGAGGATCGATCCTTTTTGGTTTCAAGAACCTTCAACACCAAAAGCAACACCACGTGGGGTTTTATGAGTAACTTCCCAATCAAAACCATTCAAGAAAAACGTCCTTTAGAACTCGAAGAAGACGAAGAACAACCAATTCCCGCAAGAAAAATCTCCAAATACCAAAACCTCGAACTCGGATTAGGGTTCCTCGACCTCGCAATCGACCAATCCCGTGATTCCGATTCCAACTCCAATTCCAATTCGGATTCCGA...

CDS

Download CDS FASTA

1320 bp · LXL04_011487|LXL04_011487|OH1004|CDS

ATGTTGGAGGATCGATCCTTTTTGGTTTCAAGAACCTTCAACACCAAAAGCAACACCACGTGGGGTTTTATGAGTAACTTCCCAATCAAAACCATTCAAGAAAAACGTCCTTTAGAACTCGAAGAAGACGAAGAACAACCAATTCCCGCAAGAAAAATCTCCAAATACCAAAACCTCGAACTCGGATTAGGGTTCCTCGACCTCGCAATCGACCAATCCCGTGATTCCGATTCCAACTCCAATTCCAATTCGGATTCCGA...

Protein

Download Protein FASTA

439 aa · LXL04_011487|LXL04_011487|OH1004|PROTEIN

MLEDRSFLVSRTFNTKSNTTWGFMSNFPIKTIQEKRPLELEEDEEQPIPARKISKYQNLELGLGFLDLAIDQSRDSDSNSNSNSDSDSDSTSLIHAIGRDNSISCLLRCSRSDYGALASLNRTFRDLISTGELYRLRRKNNIIEHWVYFSCHLVQWEAFDPINQRWMHLPTMSSNTCFQFSDKESLAVGTELLVLGKEVMDHVIYKYSLLTNSWSFGQLMNLPRCLFGSASLGEIAIVAGGSDPNGKIMNSAELYNSESG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011487`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011487

Location Chr02:165341583-165342902 (-)

Description Similar to SKIP11: F-box/kelch-repeat protein SKIP11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02870`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g26930`	F-box/kelch-repeat protein At1g26930.	No verified direct reference in this release
`At1g74510`	F-box/kelch-repeat protein At1g74510.	No verified direct reference in this release
`At5g60570`	F-box/kelch-repeat protein At5g60570.	No verified direct reference in this release
`At3g27150`	F-box/kelch-repeat protein At3g27150.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011487 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G26930

ath:AT1G74510

ath:AT2G02870

ath:AT3G27150

ath:AT5G60570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.780

Rank 1 · LXL04_011487 · OH-1004

Cytoplasm0.215

Rank 2 · LXL04_011487 · OH-1004

Cell membrane0.053

Rank 3 · LXL04_011487 · OH-1004

Plastid0.038

Rank 4 · LXL04_011487 · OH-1004

Endoplasmic reticulum0.030

Rank 5 · LXL04_011487 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24981.2Beta-prop_ATRN-LZTR1141-293 aa

PF13415.13Beta-prop_FBX42202-295 aa

PF24681.2Kelch_KLHDC2_KLHL20_DRC7204-328 aa

PF01344.32Kelch_1223-268 aa

PF13964.13Beta-prop_Calicin234-378 aa

PF25210.2Kelch_FKB95240-319 aa

PF01344.32Kelch_1271-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011487	`PF24981.2`	Beta-prop_ATRN-LZTR1	141	293	6.5e-08	32.9
LXL04_011487	`PF13415.13`	Beta-prop_FBX42	202	295	8.5e-06	26.3
LXL04_011487	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	204	328	4.1e-07	30.2
LXL04_011487	`PF01344.32`	Kelch_1	223	268	2e-25	88.6
LXL04_011487	`PF13964.13`	Beta-prop_Calicin	234	378	1.3e-09	38.2
LXL04_011487	`PF25210.2`	Kelch_FKB95	240	319	1.5e-13	51.7
LXL04_011487	`PF01344.32`	Kelch_1	271	320	2e-25	88.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L736`	Arabidopsis thaliana	F-box/kelch-repeat protein SKIP11	66.578%	Swiss-Prot	strong database homology
`Q84M94`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g26930	62.500%	Swiss-Prot	strong database homology
`Q9CA63`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g74510	59.885%	Swiss-Prot	strong database homology
`Q9FKJ0`	Arabidopsis thaliana	F-box/kelch-repeat protein At5g60570	47.042%	Swiss-Prot	moderate database homology
`Q9LI89`	Arabidopsis thaliana	F-box/kelch-repeat protein At3g27150	33.333%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card