TkA03G585620 | RubberDandelionOmics

Gene overview

TkA03G585620

Reference: TK1151 Chr: Chr03 Coordinates: 148743262-148743870 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA03G585620|TK1151|cDNA

ATGTCGCCTGAAAAGGTTCAATCACTCAACATCCATCTATTTCTTGCTCAAGCCATAATGTTATTAGCCGGAAACGGGCCCCACGTGAGTCAGCCGATGACCACTGGTCCCTCGAGCCCAGTGTCAATTGGCGCATCAACCGGCATGGGCTCAGGGGTGGCGATGGATGCTACAAAAGCCATGACCTCGCTTCGACGAGTCATGCAATCAGCGGTTCCTCAAATGCGGGGAGCATCTTTGGCTAGGTTTCTTGAGAAACG...

CDS

Download CDS FASTA

324 bp · TkA03G585620|TK1151|CDS

ATGTCGCCTGAAAAGGTTCAATCACTCAACATCCATCTATTTCTTGCTCAAGCCATAATGTTATTAGCCGGAAACGGGCCCCACGTGAGTCAGCCGATGACCACTGGTCCCTCGAGCCCAGTGTCAATTGGCGCATCAACCGGCATGGGCTCAGGGGTGGCGATGGATGCTACAAAAGCCATGACCTCGCTTCGACGAGTCATGCAATCAGCGGTTCCTCAAATGCGGGGAGCATCTTTGGCTAGGTTTCTTGAGAAACG...

Protein

Download Protein FASTA

107 aa · TkA03G585620|TK1151|PROTEIN

MSPEKVQSLNIHLFLAQAIMLLAGNGPHVSQPMTTGPSSPVSIGASTGMGSGVAMDATKAMTSLRRVMQSAVPQMRGASLARFLEKRKESKSMVPGSSSTINKNDEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G585620`
TK1151 ID	TkA03G585620
OH-1004 ID	LXL04_021186
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	41.700
Protein coverage (%)	TK1151 82.243 / OH-1004 40.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G585620`
Location	Chr03:148743262-148743870 (-)
Description	Similar to TIFY6B: Protein TIFY 6B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021186` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006952 defense response Biological Process GO:0009409 response to cold Biological Process GO:0009611 response to wounding Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process GO:0009867 jasmonic acid mediated signaling pathway Biological Process GO:0031347 regulation of defense response Biological Process GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0042802 identical protein binding Molecular Function
KEGG gene cross-reference	ath:AT1G48500 ath:AT1G70700 ath:AT3G17860 dosa:Os08g0428400 dosa:Os09g0401300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.500

Rank 1 · TkA03G585620 · TK1151

Cytoplasm0.417

Rank 2 · TkA03G585620 · TK1151

Mitochondrion0.086

Rank 3 · TkA03G585620 · TK1151

Cell membrane0.072

Rank 4 · TkA03G585620 · TK1151

Endoplasmic reticulum0.058

Rank 5 · TkA03G585620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09425Jas_motif63-68 aa

PF09425Jas_motif73-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G585620	`PF09425`	Jas_motif	63	68	7.5e-06	26.3
TkA03G585620	`PF09425`	Jas_motif	73	89	7.5e-06	26.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card