LXL04_021186 | RubberDandelionOmics

Gene overview

LXL04_021186

Reference: OH-1004 Chr: Chr04 Coordinates: 123788488-123790655 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

828 bp · LXL04_021186|LXL04_021186|OH1004|cDNA

ATGGAAAGGGATTTTATGGGTTTGAATTCGAAAGATTCAGTGGTGGTGGTCAAGGAAGAAGCTGTTGAAGGATGCAAAGAATCAGATGGTTTCAATGGCTCTAAAAACCGTCAATCTGGTGAACTTCAGAAAAGCTTTGGTGTAAGTACGCAAGGTGGCACTCATTTTACAATGGCTGGTTATCCCATGCAACAGAATGCGGTGCCAATTTCCATGAGTCATCCCTTCTTCCGGGCCCCATTTGGATCTGCTCCAATCAA...

CDS

Download CDS FASTA

828 bp · LXL04_021186|LXL04_021186|OH1004|CDS

ATGGAAAGGGATTTTATGGGTTTGAATTCGAAAGATTCAGTGGTGGTGGTCAAGGAAGAAGCTGTTGAAGGATGCAAAGAATCAGATGGTTTCAATGGCTCTAAAAACCGTCAATCTGGTGAACTTCAGAAAAGCTTTGGTGTAAGTACGCAAGGTGGCACTCATTTTACAATGGCTGGTTATCCCATGCAACAGAATGCGGTGCCAATTTCCATGAGTCATCCCTTCTTCCGGGCCCCATTTGGATCTGCTCCAATCAA...

Protein

Download Protein FASTA

275 aa · LXL04_021186|LXL04_021186|OH1004|PROTEIN

MERDFMGLNSKDSVVVVKEEAVEGCKESDGFNGSKNRQSGELQKSFGVSTQGGTHFTMAGYPMQQNAVPISMSHPFFRAPFGSAPIKQQHAVNVIPPNASFLAGTTEPWYSSKTSCAPSQLTIFYGGMVNVYDDISPEKAQAIMFLAGNGVSVSTPTPRTQAQAQVAPTLSPINVQPCSAISSPMSVSSHPVGGPTNKDDGVKTVTPPTKVDSPRVINSLEKVMQSAVPQARKASLARFLEKRKERVMGSGPYNKISSDC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021186`
TK1151 ID	TkA03G585620
OH-1004 ID	LXL04_021186
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	41.700
Protein coverage (%)	TK1151 82.243 / OH-1004 40.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021186

Location Chr04:123788488-123790655 (+)

Description Similar to TIFY6B: Protein TIFY 6B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17860`	Repressor of jasmonate responses.	The JAZ family of repressors is the missing link in jasmonate signalling.2007 · DOI: 10.1038/nature06006
`At1g48500`	Repressor of jasmonate responses.	No verified direct reference in this release
`At1g70700`	Repressor of jasmonate responses.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0401300`	Repressor of jasmonate responses.	No verified direct reference in this release
`Os08g0428400`	Repressor of jasmonate responses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021186 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0031347 regulation of defense response Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G48500

ath:AT1G70700

ath:AT3G17860

dosa:Os08g0428400

dosa:Os09g0401300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.922

Rank 1 · LXL04_021186 · OH-1004

Cytoplasm0.148

Rank 2 · LXL04_021186 · OH-1004

Cell membrane0.061

Rank 3 · LXL04_021186 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_021186 · OH-1004

Plastid0.017

Rank 5 · LXL04_021186 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06200.20tify117-148 aa

PF09425.16Jas_motif229-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021186	`PF06200.20`	tify	117	148	3.4e-17	62.2
LXL04_021186	`PF09425.16`	Jas_motif	229	253	5e-13	49.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVI4`	Arabidopsis thaliana	Protein TIFY 6B	34.706%	Swiss-Prot	moderate database homology
`Q58G47`	Arabidopsis thaliana	Protein TIFY 6A	36.842%	Swiss-Prot	moderate database homology
`Q8W4J8`	Arabidopsis thaliana	Protein TIFY 7	33.948%	Swiss-Prot	moderate database homology
`Q6ES51`	Oryza sativa subsp. japonica	Protein TIFY 6b	39.894%	Swiss-Prot	moderate database homology
`Q6ZJU3`	Oryza sativa subsp. japonica	Protein TIFY 6a	37.705%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card