TkA03G581860 | RubberDandelionOmics

Gene overview

TkA03G581860

Reference: TK1151 Chr: Chr03 Coordinates: 147702887-147705739 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1405 bp · TkA03G581860|TK1151|cDNA

TTACATAGATTGAGCGCAAGATTGGGGATATGGAGGCTGAAGCACCGCTGTGTGGTAGGTTGGCTAACATGCACCGCGCCTTCTAAACCAAATTCCAGTAAAACCCCCGAAAATCAAAGTCGAAATTTCACCGGAAAATATCGAGGAACAATGGGAACATCAAATGCTCTCTTCAACCTTCAGCTCAACACAAACAATTGCGTCAATTGTATGAGATCGAGAACAAATCATTCAAATTCTTTGCAGATCAATCAAAATAA...

CDS

Download CDS FASTA

1176 bp · TkA03G581860|TK1151|CDS

TTACATAGATTGAGCGCAAGATTGGGGATATGGAGGCTGAAGCACCGCTGTGTGGTAGGTTGGCTAACATGCACCGCGCCTTCTAAACCAAATTCCAGTAAAACCCCCGAAAATCAAAGTCGAAATTTCACCGGAAAATATCGAGGAACAATGGGAACATCAAATGCTCTCTTCAACCTTCAGCTCAACACAAACAATTGCGTCAATTGTATGAGATCGAGAACAAATCATTCAAATTCTTTGCAGATCAATCAAAATAA...

Protein

Download Protein FASTA

391 aa · TkA03G581860|TK1151|PROTEIN

LHRLSARLGIWRLKHRCVVGWLTCTAPSKPNSSKTPENQSRNFTGKYRGTMGTSNALFNLQLNTNNCVNCMRSRTNHSNSLQINQNKTYLSLPNKRQKKVNRGVCFAFDDMRDLELKLGIIRDRPKVVEEIKEETPPETGGAMYNFLYPDKELLPEDKEMSLFDHLEELRGRLLVSVLAVGAAIIGCFAYSKELIMLLEAPVSSQGVRFLQLAPGEFFFTTIKVSGYCGILLGSPVILFEIIAFVLPGLTKSERKFLAPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G581860`
TK1151 ID	TkA03G581860
OH-1004 ID	LXL04_011312
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.721 / OH-1004 65.983 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G581860

Location Chr03:147702887-147705739 (+)

Description Similar to TATC: Sec-independent protein translocase protein TATC, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01110`	Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in their signal peptide across the thylakoid membrane.	An essential role of a TatC homologue of a Delta pH- dependent protein transporter in thylakoid membrane formation during chloroplast development in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.181304598

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0501700`	Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across the thylakoid membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011312 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0043953 protein transport by the Tat complex Biological Process

GO:0045038 protein import into chloroplast thylakoid membrane Biological Process

GO:0065002 intracellular protein transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0033281 TAT protein transport complex Cellular Component

GO:0042651 thylakoid membrane Cellular Component

GO:0043235 receptor complex Cellular Component

GO:0009977 proton motive force dependent protein transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G01110

dosa:Os01g0501700

syn:sll0194

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.983

Rank 1 · TkA03G581860 · TK1151

Mitochondrion0.021

Rank 2 · TkA03G581860 · TK1151

Nucleus0.015

Rank 3 · TkA03G581860 · TK1151

Cytoplasm0.013

Rank 4 · TkA03G581860 · TK1151

Peroxisome0.010

Rank 5 · TkA03G581860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23071DUF704455-91 aa

PF00902TatC164-372 aa

PF10716NdhL229-239 aa

PF10716NdhL266-325 aa

PF24378DUF7534350-374 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G581860	`PF23071`	DUF7044	55	91	0.084	13.8
TkA03G581860	`PF00902`	TatC	164	372	7.9e-65	219.3
TkA03G581860	`PF10716`	NdhL	229	239	9.2	7.0
TkA03G581860	`PF10716`	NdhL	266	325	9.2	7.0
TkA03G581860	`PF24378`	DUF7534	350	374	0.097	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJV5`	Arabidopsis thaliana	sp\|Q9SJV5\|TATC_ARATH Sec-independent protein translocase protein TATC, chloroplastic	80.800%	Swiss-Prot	Medium
`Q9AVE6`	Oryza sativa subsp. japonica	sp\|Q9AVE6\|TATC_ORYSJ Sec-independent protein translocase protein TATC, chloroplastic	83.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card