LXL04_011312 | RubberDandelionOmics

Gene overview

LXL04_011312

Reference: OH-1004 Chr: Chr02 Coordinates: 162390144-162392793 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1758 bp · LXL04_011312|LXL04_011312|OH1004|cDNA

ATGGCATCGGAAACTAAAAAGCAATCGTTGTTCCCAACGGACAGGGAGGAAATAAAGGTCATTTTCAACCGTTTCGACACCAATGGCGACGGTAGTATCTCTGAGGAGGAGCTAATCGGCGTCCTGAAGTCCCTCGGATCCGATACATCTCCAGACGAGGTTAAGAGAATCATGAAAGAAATTGATACCGACTCCGACGGTTCCATTAGCCTGGATGAGTTTGTCGGATTCTGTAAAGGAATCGCCGGAGATTCCGAGGA...

CDS

Download CDS FASTA

1758 bp · LXL04_011312|LXL04_011312|OH1004|CDS

ATGGCATCGGAAACTAAAAAGCAATCGTTGTTCCCAACGGACAGGGAGGAAATAAAGGTCATTTTCAACCGTTTCGACACCAATGGCGACGGTAGTATCTCTGAGGAGGAGCTAATCGGCGTCCTGAAGTCCCTCGGATCCGATACATCTCCAGACGAGGTTAAGAGAATCATGAAAGAAATTGATACCGACTCCGACGGTTCCATTAGCCTGGATGAGTTTGTCGGATTCTGTAAAGGAATCGCCGGAGATTCCGAGGA...

Protein

Download Protein FASTA

585 aa · LXL04_011312|LXL04_011312|OH1004|PROTEIN

MASETKKQSLFPTDREEIKVIFNRFDTNGDGSISEEELIGVLKSLGSDTSPDEVKRIMKEIDTDSDGSISLDEFVGFCKGIAGDSEDEDLKETFKLYDQDNNGKISASELHQILSRLGEMYTIENCKDMIKSVDADGDGHVDFEEFKKMILSARLGIWRLKHRCVVGWLTCTAPSKPNSSKTPENQSRNFTGKYRGTMGTSNALFNLQLNTNNCVNCMRSRTNHSNSLQINQNKTYLSLPNKRQKKVNRGVCFAFDDMRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011312`
TK1151 ID	TkA03G581860
OH-1004 ID	LXL04_011312
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.721 / OH-1004 65.983 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011312

Location Chr02:162390144-162392793 (+)

Description Similar to TATC: Sec-independent protein translocase protein TATC, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01110`	Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in their signal peptide across the thylakoid membrane.	An essential role of a TatC homologue of a Delta pH- dependent protein transporter in thylakoid membrane formation during chloroplast development in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.181304598

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0501700`	Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across the thylakoid membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011312 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0043953 protein transport by the Tat complex Biological Process

GO:0045038 protein import into chloroplast thylakoid membrane Biological Process

GO:0065002 intracellular protein transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0033281 TAT protein transport complex Cellular Component

GO:0042651 thylakoid membrane Cellular Component

GO:0043235 receptor complex Cellular Component

GO:0009977 proton motive force dependent protein transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G01110

dosa:Os01g0501700

syn:sll0194

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_011312 · OH-1004

Mitochondrion0.026

Rank 2 · LXL04_011312 · OH-1004

Cytoplasm0.018

Rank 3 · LXL04_011312 · OH-1004

Nucleus0.017

Rank 4 · LXL04_011312 · OH-1004

Peroxisome0.015

Rank 5 · LXL04_011312 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10591.16SPARC_Ca_bdg5-75 aa

PF13499.13EF-hand_716-78 aa

PF13833.13EF-hand_816-44 aa

PF00036.39EF-hand_117-45 aa

PF13405.13EF-hand_617-46 aa

PF13202.13EF-hand_520-39 aa

PF13833.13EF-hand_844-77 aa

PF00036.39EF-hand_153-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011312	`PF10591.16`	SPARC_Ca_bdg	5	75	1.7e-09	38.7
LXL04_011312	`PF13499.13`	EF-hand_7	16	78	3.7e-32	111.2
LXL04_011312	`PF13833.13`	EF-hand_8	16	44	2.3e-20	72.8
LXL04_011312	`PF00036.39`	EF-hand_1	17	45	3.3e-32	108.3
LXL04_011312	`PF13405.13`	EF-hand_6	17	46	4.9e-28	94.8
LXL04_011312	`PF13202.13`	EF-hand_5	20	39	7.2e-24	82.8
LXL04_011312	`PF13833.13`	EF-hand_8	44	77	2.3e-20	72.8
LXL04_011312	`PF00036.39`	EF-hand_1	53	79	3.3e-32	108.3
LXL04_011312	`PF13499.13`	EF-hand_7	88	150	3.7e-32	111.2
LXL04_011312	`PF21008.4`	AIF-1	88	160	4.6e-11	43.8
LXL04_011312	`PF00036.39`	EF-hand_1	89	116	3.3e-32	108.3
LXL04_011312	`PF13405.13`	EF-hand_6	89	118	4.9e-28	94.8
LXL04_011312	`PF13202.13`	EF-hand_5	90	113	7.2e-24	82.8
LXL04_011312	`PF00036.39`	EF-hand_1	126	150	3.3e-32	108.3
LXL04_011312	`PF13202.13`	EF-hand_5	127	149	7.2e-24	82.8
LXL04_011312	`PF00902.24`	TatC	311	519	1.9e-64	218.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJV5`	Arabidopsis thaliana	Sec-independent protein translocase protein TATC, chloroplastic	66.374%	Swiss-Prot	moderate database homology
`Q9AVE6`	Oryza sativa subsp. japonica	Sec-independent protein translocase protein TATC, chloroplastic	84.127%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card