Gene Card
Gene overview
cDNA / CDS / Protein Sequences
402 bp · TkA03G561180|TK1151|cDNA
ATGTTATCGGGTACTATCCCTACGGTTTTAGGTCGCCAGTCAAAAATGACGCTTCTTGACCTTTCAAATAACCGTTTTACAGGGAACATTCCTAGTACGGTTTCGAATCTTGGGAATCTTGCAAGGTTTGATATTTCGAGGAATCGGATCACGGGAACAATTCCTCCAAGTTTGGGGAAATTGTCGAAATTAGGGTGGTTGGATATATCGAGTAATTCAATTGGAGGAAAGATACCAACGAGTTTATTGGTGATTAAATA...
402 bp · TkA03G561180|TK1151|CDS
ATGTTATCGGGTACTATCCCTACGGTTTTAGGTCGCCAGTCAAAAATGACGCTTCTTGACCTTTCAAATAACCGTTTTACAGGGAACATTCCTAGTACGGTTTCGAATCTTGGGAATCTTGCAAGGTTTGATATTTCGAGGAATCGGATCACGGGAACAATTCCTCCAAGTTTGGGGAAATTGTCGAAATTAGGGTGGTTGGATATATCGAGTAATTCAATTGGAGGAAAGATACCAACGAGTTTATTGGTGATTAAATA...
Protein
Download Protein FASTA133 aa · TkA03G561180|TK1151|PROTEIN
MLSGTIPTVLGRQSKMTLLDLSNNRFTGNIPSTVSNLGNLARFDISRNRITGTIPPSLGKLSKLGWLDISSNSIGGKIPTSLLVIKYLRHVNFRGNKLCGEIPQGRPLNVFPEAAYAHNLCLCGKPLSPCKQG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G561180 |
|---|---|
| TK1151 ID | TkA03G561180 |
| OH-1004 ID | LXL04_011026 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 22.556 / OH-1004 5.348Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G561180 |
|---|---|
| Location | Chr03:142348841-142349890 (+) |
| Description | Similar to PXC2: Leucine-rich repeat receptor-like protein kinase PXC2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002213 defense response to insect Biological Process GO:0002237 response to molecule of bacterial origin Biological Process GO:0009695 jasmonic acid biosynthetic process Biological Process GO:0009755 hormone-mediated signaling pathway Biological Process GO:0009759 indole glucosinolate biosynthetic process Biological Process GO:0010183 pollen tube guidance Biological Process GO:0031349 positive regulation of defense response Biological Process GO:0048364 root development Biological Process GO:0051302 regulation of cell division Biological Process GO:0080027 response to herbivore Biological Process GO:0090511 periclinal cell division Biological Process GO:1901653 cellular response to peptide Biological Process |
| KEGG gene cross-reference | ath:AT3G56370 ath:AT4G08850 ath:AT5G01890 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00560LRR_12-11 aaPF24141LRR_ComC3-81 aaPF23211LRR_LRWD17-32 aaPF25013LRR_Zer-111-73 aaPF23598LRR_1414-88 aaPF13855LRR_815-74 aaPF13516LRR_615-28 aaPF00560LRR_117-37 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G561180 | PF00560 | LRR_1 | 2 | 11 | 1.4e-16 | 57.8 |
| TkA03G561180 | PF24141 | LRR_ComC | 3 | 81 | 0.024 | 15.0 |
| TkA03G561180 | PF23211 | LRR_LRWD1 | 7 | 32 | 0.0066 | 16.9 |
| TkA03G561180 | PF25013 | LRR_Zer-1 | 11 | 73 | 0.25 | 12.2 |
| TkA03G561180 | PF23598 | LRR_14 | 14 | 88 | 0.00039 | 20.0 |
| TkA03G561180 | PF13855 | LRR_8 | 15 | 74 | 7.8e-14 | 51.9 |
| TkA03G561180 | PF13516 | LRR_6 | 15 | 28 | 0.00018 | 22.0 |
| TkA03G561180 | PF00560 | LRR_1 | 17 | 37 | 1.4e-16 | 57.8 |
| TkA03G561180 | PF12799 | LRR_4 | 17 | 51 | 1.2e-05 | 26.1 |
| TkA03G561180 | PF25019 | LRR_R13L1-DRL21 | 17 | 70 | 0.19 | 12.4 |
| TkA03G561180 | PF00560 | LRR_1 | 39 | 61 | 1.4e-16 | 57.8 |
| TkA03G561180 | PF12799 | LRR_4 | 39 | 73 | 1.2e-05 | 26.1 |
| TkA03G561180 | PF13855 | LRR_8 | 40 | 98 | 7.8e-14 | 51.9 |
| TkA03G561180 | PF13516 | LRR_6 | 42 | 52 | 0.00018 | 22.0 |
| TkA03G561180 | PF23211 | LRR_LRWD1 | 55 | 113 | 0.0066 | 16.9 |
| TkA03G561180 | PF00560 | LRR_1 | 64 | 82 | 1.4e-16 | 57.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.