LXL04_011026 | RubberDandelionOmics

Gene overview

LXL04_011026

Reference: OH-1004 Chr: Chr02 Coordinates: 156660231-156661916 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1686 bp · LXL04_011026|LXL04_011026|OH1004|cDNA

ATGCCGAAACCTTCATGGGCTTTCAAAATCTTGACCATTTTAACCTTCCTTCATCTCTCTTTCCTCTCACAATCCCAAGCTGCCCCTACATGTCAAGAAGCCGATAGGGTTGCCCTTATTGGATTCAAAGCTCGAATCTTTAAGGACACTACCGGGATTATGTCATCTTGGGTAGGCAAAGATTGTTGTTCAGGAAACTGGGAAGGGATCCAGTGTGACCCATCCACAGGGAGGGTCACCGGGGTAATTTTACAAGGGCC...

CDS

Download CDS FASTA

1686 bp · LXL04_011026|LXL04_011026|OH1004|CDS

ATGCCGAAACCTTCATGGGCTTTCAAAATCTTGACCATTTTAACCTTCCTTCATCTCTCTTTCCTCTCACAATCCCAAGCTGCCCCTACATGTCAAGAAGCCGATAGGGTTGCCCTTATTGGATTCAAAGCTCGAATCTTTAAGGACACTACCGGGATTATGTCATCTTGGGTAGGCAAAGATTGTTGTTCAGGAAACTGGGAAGGGATCCAGTGTGACCCATCCACAGGGAGGGTCACCGGGGTAATTTTACAAGGGCC...

Protein

Download Protein FASTA

561 aa · LXL04_011026|LXL04_011026|OH1004|PROTEIN

MPKPSWAFKILTILTFLHLSFLSQSQAAPTCQEADRVALIGFKARIFKDTTGIMSSWVGKDCCSGNWEGIQCDPSTGRVTGVILQGPPDNNAIYMKGAISPTLSDLKFLKLVVISGMKKLSGAIPSFTGLIYLTQIVLDDNSLNGNIPSSLGQLRSLQTLSLSGNDLIGPIPQSLGNLRNLLQINLARNSLTGTLNFPNLGTNLEYLDVSYNMLSGTIPTVLGRQSKMTLLDLSNNRFTGQIPDSLCNLRSLVDLSLSNN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011026`
TK1151 ID	TkA03G561180
OH-1004 ID	LXL04_011026
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 22.556 / OH-1004 5.348 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011026

Location Chr02:156660231-156661916 (+)

Description Similar to PXC2: Leucine-rich repeat receptor-like protein kinase PXC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01890`	Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development.	No verified direct reference in this release
`At3g56370`	Probable LRR receptor-like serine/threonine-protein kinase IRK.	No verified direct reference in this release
`At4g08850`	Acts as a receptor of SCOOP peptides from Brassicaceae plants regulating multiple processing including plant growth, development and stress responses.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975 Perception of a divergent family of phytocytokines by the Arabidopsis receptor kinase MIK2.2021 · DOI: 10.1038/s41467-021-20932-y The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w The MIK2/SCOOP Signaling System Contributes to Arabidopsis Resistance Against Herbivory by Modulating Jasmonate and Indole Glucosinolate Biosynthesis.2022 · DOI: 10.3389/fpls.2022.852808
`At1g12460`	Probable LRR receptor-like serine/threonine-protein kinase At1g12460.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0576900`	Functions in the early stages of organ development by regulating cell division rate.	XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011026 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009759 indole glucosinolate biosynthetic process Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0048364 root development Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0080027 response to herbivore Biological Process

GO:0090511 periclinal cell division Biological Process

GO:1901653 cellular response to peptide Biological Process

KEGG gene cross-reference

ath:AT3G56370

ath:AT4G08850

ath:AT5G01890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.473

Rank 1 · LXL04_011026 · OH-1004

Cell membrane0.284

Rank 2 · LXL04_011026 · OH-1004

Endoplasmic reticulum0.104

Rank 3 · LXL04_011026 · OH-1004

Cytoplasm0.068

Rank 4 · LXL04_011026 · OH-1004

Nucleus0.029

Rank 5 · LXL04_011026 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_234-73 aa

PF23598.2LRR_1499-207 aa

PF13855.13LRR_8126-167 aa

PF13855.13LRR_8202-262 aa

PF23598.2LRR_14203-375 aa

PF12799.14LRR_4251-291 aa

PF29594.1LRR_SKP2253-382 aa

PF13855.13LRR_8272-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011026	`PF08263.18`	LRRNT_2	34	73	2.4e-07	31.6
LXL04_011026	`PF23598.2`	LRR_14	99	207	1.2e-22	80.9
LXL04_011026	`PF13855.13`	LRR_8	126	167	6.5e-35	119.4
LXL04_011026	`PF13855.13`	LRR_8	202	262	6.5e-35	119.4
LXL04_011026	`PF23598.2`	LRR_14	203	375	1.2e-22	80.9
LXL04_011026	`PF12799.14`	LRR_4	251	291	8.6e-23	80.6
LXL04_011026	`PF29594.1`	LRR_SKP2	253	382	4.6e-06	26.8
LXL04_011026	`PF13855.13`	LRR_8	272	309	6.5e-35	119.4
LXL04_011026	`PF13855.13`	LRR_8	444	502	6.5e-35	119.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZV7`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase PXC2	33.737%	Swiss-Prot	moderate database homology
`Q9LY03`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase IRK	33.039%	Swiss-Prot	moderate database homology
`Q8VZG8`	Arabidopsis thaliana	MDIS1-interacting receptor like kinase 2	31.652%	Swiss-Prot	moderate database homology
`C0LGE4`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g12460	28.623%	Swiss-Prot	weak database homology
`G9LZD7`	Oryza sativa subsp. japonica	Probable inactive leucine-rich repeat receptor kinase XIAO	34.677%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card