TkA03G561150 | RubberDandelionOmics

Gene overview

TkA03G561150

Reference: TK1151 Chr: Chr03 Coordinates: 142341901-142345240 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1408 bp · TkA03G561150|TK1151|cDNA

AATACTCCTGCTTGGATAATGGCACGTGACATTAGCCTTTCCTCTTCATATTTCTTTCTGGGTACGGAGGGAGTAGGCTTCGTTTCTATCTTGTTATCGACCTTCGACCACCACCGAAACAACACCGGAGCAGAAGGTGTCTTCCACCTTCTCTAATGGCGATTACCGCAACTGCGACTTCTTCCCTCTTCAACTTCAACTGCTCCCTGTTCCATCCACCATCACTAAGCTGTCCTCCAATTCTCCCTTCTCTCCCACAC...

CDS

Download CDS FASTA

1047 bp · TkA03G561150|TK1151|CDS

ATGGCGATTACCGCAACTGCGACTTCTTCCCTCTTCAACTTCAACTGCTCCCTGTTCCATCCACCATCACTAAGCTGTCCTCCAATTCTCCCTTCTCTCCCACACCACCATCTCCGCCTAACCCTCGCCAGAAAATTCGGTATTTTCACTACTCTGCCCGACCGAAAACCCTTCATCTCAAACCCTTCGGTGTGCTCTTCGTCCGCTGGAAAATCTCAGCCGATGGTTCCTCCTTATAATATCCTAATCACTGGCTCCAC...

Protein

Download Protein FASTA

348 aa · TkA03G561150|TK1151|PROTEIN

MAITATATSSLFNFNCSLFHPPSLSCPPILPSLPHHHLRLTLARKFGIFTTLPDRKPFISNPSVCSSSAGKSQPMVPPYNILITGSTKGIGYALAKEFLKAGDNVLICSRSAERVESAIQTLRAESGVQHVWGTKCDVRDGNDVKNLVKYAQENLQYIDIWINNAGSNAYSYKPLAEASDEDLIEVVTTNTLGLMICCREAMKMMLNQPRGGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQEVSNVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G561150`
TK1151 ID	TkA03G561150
OH-1004 ID	LXL04_011025
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G561150

Location Chr03:142341901-142345240 (+)

Description Similar to NOL: Chlorophyll(ide) b reductase NOL, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04900`	Required for chlorophyll b degradation.	No verified direct reference in this release
`At4g13250`	Involved in chlorophyll b degradation.	Participation of chlorophyll b reductase in the initial step of the degradation of light-harvesting chlorophyll a/b-protein complexes in Arabidopsis.2009 · DOI: 10.1074/jbc.m109.008912

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0654600`	Required for chlorophyll b degradation.	No verified direct reference in this release
`Os01g0227100`	Required for proper chloroplast degradation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011025 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006718 juvenile hormone biosynthetic process Biological Process

GO:0010304 PSII associated light-harvesting complex II catabolic process Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0034256 chlorophyll(ide) b reductase activity Molecular Function

GO:0047886 farnesol dehydrogenase activity Molecular Function

KEGG gene cross-reference

aag:23687722

ath:AT4G13250

ath:AT5G04900

dosa:Os01g0227100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.966

Rank 1 · TkA03G561150 · TK1151

Mitochondrion0.042

Rank 2 · TkA03G561150 · TK1151

Nucleus0.020

Rank 3 · TkA03G561150 · TK1151

Cytoplasm0.020

Rank 4 · TkA03G561150 · TK1151

Cell membrane0.014

Rank 5 · TkA03G561150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23441SDR80-277 aa

PF04321RmlD_sub_bind80-153 aa

PF00106adh_short81-276 aa

PF08659KR81-189 aa

PF01370Epimerase81-267 aa

PF02719Polysacc_synt_281-205 aa

PF16363GDP_Man_Dehyd82-151 aa

PF13561adh_short_C287-281 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G561150	`PF23441`	SDR	80	277	1.4e-07	31.9
TkA03G561150	`PF04321`	RmlD_sub_bind	80	153	0.18	11.6
TkA03G561150	`PF00106`	adh_short	81	276	2.2e-43	148.7
TkA03G561150	`PF08659`	KR	81	189	4.2e-08	34.0
TkA03G561150	`PF01370`	Epimerase	81	267	3.2e-06	27.4
TkA03G561150	`PF02719`	Polysacc_synt_2	81	205	0.0042	17.0
TkA03G561150	`PF16363`	GDP_Man_Dehyd	82	151	0.004	17.4
TkA03G561150	`PF13561`	adh_short_C2	87	281	2.1e-31	110.1
TkA03G561150	`PF03807`	F420_oxidored	90	123	0.021	16.1
TkA03G561150	`PF16363`	GDP_Man_Dehyd	232	268	0.004	17.4
TkA03G561150	`PF08659`	KR	239	287	4.2e-08	34.0
TkA03G561150	`PF03807`	F420_oxidored	259	291	0.021	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LEU3`	Arabidopsis thaliana	sp\|Q8LEU3\|NOL_ARATH Chlorophyll(ide) b reductase NOL, chloroplastic	75.800%	Swiss-Prot	High
`Q93ZA0`	Arabidopsis thaliana	sp\|Q93ZA0\|NYC1_ARATH Probable chlorophyll(ide) b reductase NYC1, chloroplastic	42.000%	Swiss-Prot	Medium
`Q84ST4`	Oryza sativa subsp. japonica	sp\|Q84ST4\|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic	82.100%	Swiss-Prot	High
`Q5N800`	Oryza sativa subsp. japonica	sp\|Q5N800\|NYC1_ORYSJ Probable chlorophyll(ide) b reductase NYC1, chloroplastic	44.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card