TkA03G560510 | RubberDandelionOmics

Gene overview

TkA03G560510

Reference: TK1151 Chr: Chr03 Coordinates: 142144253-142150877 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1094 bp · TkA03G560510|TK1151|cDNA

ATGCTCATGGTGCACCAATGTTGCTATCTGAATTACTCGAAGCTCTCCCCATTAACAAGGAGAAAAACGTCATTTGTCTATCAACTTATGCTCATTCTTATCCACTCTGCGTTCTTCATCAAAGAACAAATATCCACAATTAAAGGCAATGGTGAAGAGGGAAAAGAAGGCTATCTGCTAACCCCTGCTTCTCGACTTCTTCTTAAAGACGAACCATTAAGCTTGAGTCCCGTTTTGCTATTCATGTTGGATCCATTATT...

CDS

Download CDS FASTA

963 bp · TkA03G560510|TK1151|CDS

ATGCTCATGGTGCACCAATGTTGCTATCTGAATTACTCGAAGCTCTCCCCATTAACAAGGAGAAAAACGTCATTTGTCTATCAACTTATGCTCATTCTTATCCACTCTGCGTTCTTCATCAAAGAACAAATATCCACAATTAAAGGCAATGGTGAAGAGGGAAAAGAAGGCTATCTGCTAACCCCTGCTTCTCGACTTCTTCTTAAAGACGAACCATTAAGCTTGAGTCCCGTTTTGCTATTCATGTTGGATCCATTATT...

Protein

Download Protein FASTA

320 aa · TkA03G560510|TK1151|PROTEIN

MLMVHQCCYLNYSKLSPLTRRKTSFVYQLMLILIHSAFFIKEQISTIKGNGEEGKEGYLLTPASRLLLKDEPLSLSPVLLFMLDPLLMDPWKHMSEWFQNNDVTPFHTTHGNSIWDVASQEPKLNQFINESMASDTRLVASIITKHCASAFQGLNSFVDVGGGTGTISKAISATFPNVTCISFDLPHVVNGLEGSTNVRYVCGDMFEAIPKADAVLLKWVLHDCNDEECIKILKRCKEAIPNKEHGGKVMIIEMVLKEKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G560510`
TK1151 ID	TkA03G560510
OH-1004 ID	LXL04_011007
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.400
Protein coverage (%)	TK1151 94.062 / OH-1004 83.056 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G560510`
Location	Chr03:142144253-142150877 (+)
Description	Similar to ROMT: Trans-resveratrol di-O-methyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011007` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009611 response to wounding Biological Process GO:0009699 phenylpropanoid biosynthetic process Biological Process GO:0009717 isoflavonoid biosynthetic process Biological Process GO:0009812 flavonoid metabolic process Biological Process GO:0032259 methylation Biological Process GO:0008171 O-methyltransferase activity Molecular Function GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function GO:0030761 8-hydroxyquercitin 8-O-methyltransferase activity Molecular Function GO:0046983 protein dimerization activity Molecular Function GO:0102303 resveratrol 3,5-O-dimethyltransferase activity Molecular Function
KEGG gene cross-reference	ag:ALG05119 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.792

Rank 1 · TkA03G560510 · TK1151

Nucleus0.295

Rank 2 · TkA03G560510 · TK1151

Endoplasmic reticulum0.054

Rank 3 · TkA03G560510 · TK1151

Peroxisome0.050

Rank 4 · TkA03G560510 · TK1151

Mitochondrion0.046

Rank 5 · TkA03G560510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08100Dimerisation15-70 aa

PF00891Methyltransf_291-300 aa

PF13489Methyltransf_23152-225 aa

PF05891Methyltransf_PK154-246 aa

PF13847Methyltransf_31157-255 aa

PF13649Methyltransf_25158-239 aa

PF08241Methyltransf_11158-235 aa

PF08242Methyltransf_12158-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G560510	`PF08100`	Dimerisation	15	70	0.24	12.1
TkA03G560510	`PF00891`	Methyltransf_2	91	300	1.3e-56	192.0
TkA03G560510	`PF13489`	Methyltransf_23	152	225	0.067	13.6
TkA03G560510	`PF05891`	Methyltransf_PK	154	246	0.014	15.6
TkA03G560510	`PF13847`	Methyltransf_31	157	255	0.36	11.3
TkA03G560510	`PF13649`	Methyltransf_25	158	239	0.00025	22.4
TkA03G560510	`PF08241`	Methyltransf_11	158	235	0.00045	21.5
TkA03G560510	`PF08242`	Methyltransf_12	158	239	0.017	16.5
TkA03G560510	`PF08242`	Methyltransf_12	267	280	0.017	16.5
TkA03G560510	`PF13649`	Methyltransf_25	271	291	0.00025	22.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card