TkA03G559480 | RubberDandelionOmics

Gene overview

TkA03G559480

Reference: TK1151 Chr: Chr03 Coordinates: 141837637-141840886 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1983 bp · TkA03G559480|TK1151|cDNA

ATACAATAAAAAAATGAAATGAATAGTATAAAATAAAGTATAAAAATAAATAAAGAGATATTTTGTGTTGGGGAAGACATTCTCCCTCCTTCCATTTTGACTTAGAACATGGCAGATGGCACCATCACCGGAGATTCCTCCATTTCATATTCATCTCTCATCTTTCCAAAACCTAGACACAAACGGAAAGAGAAAGAGAAAGAGAAAGGAGAAGACGACGATTCAGAAACTAGGGCCAATTACACAATTCGTCTTTCCTG...

CDS

Download CDS FASTA

705 bp · TkA03G559480|TK1151|CDS

ATGTCGACACATAATGTCAACACTCTTATATACTCTAGCACGTGTGCGACTTATGGTGAACCCGAAAAGATGCCGATTACAGAAGAAACCCCTCAAAATCCAATTAATCCGTATGGTAAAGCTAAAAAAATGTCGGAAGATATAATCCAGGATTTCCATCAAAATTCCGACATGGCAGTTATGATTCTAAGATACTTCAATGTAATTGGGTCGGATCCAGATGGAAGATTAGGGGAAGCTCCGAGACCTGAATTACGTGA...

Protein

Download Protein FASTA

234 aa · TkA03G559480|TK1151|PROTEIN

MSTHNVNTLIYSSTCATYGEPEKMPITEETPQNPINPYGKAKKMSEDIIQDFHQNSDMAVMILRYFNVIGSDPDGRLGEAPRPELREHGRISGACFDAARGITNGLKVRGTDYKTPDGTCIRDYIDVTDLVDAHVKALENAKPGHVGIYNVGTGKGRSVKEFVEACKKATGASIKVEYLPRRPGDYAEVYSDPSKILRELKWSAKHTDLEKSLQVAWKWQKTHHNGYSTINAIY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G559480`
TK1151 ID	TkA03G559480
OH-1004 ID	LXL04_010978
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 48.852 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G559480

Location Chr03:141837637-141840886 (+)

Description Similar to MUR4: UDP-arabinose 4-epimerase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20460`	Probable UDP-arabinose 4-epimerase 3.	No verified direct reference in this release
`At1g30620`	Acts as a UDP-D-xylose 4-epimerase but lacks both UDP-D- glucose and UDP-D-glucuronic acid 4-epimerase activities in vitro.	The biosynthesis of L-arabinose in plants: molecular cloning and characterization of a Golgi-localized UDP-D-xylose 4-epimerase encoded by the MUR4 gene of Arabidopsis.2003 · DOI: 10.1105/tpc.008425
`At5g44480`	Putative UDP-arabinose 4-epimerase 4.	No verified direct reference in this release
`At2g34850`	Putative UDP-arabinose 4-epimerase 2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0139400`	Probable UDP-arabinose 4-epimerase 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010978 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006012 galactose metabolic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0019567 arabinose biosynthetic process Biological Process

GO:0033358 UDP-L-arabinose biosynthetic process Biological Process

GO:0045227 capsule polysaccharide biosynthetic process Biological Process

GO:0048868 pollen tube development Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0032580 Golgi cisterna membrane Cellular Component

GO:0003978 UDP-glucose 4-epimerase activity Molecular Function

GO:0050373 UDP-arabinose 4-epimerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G30620

ath:AT2G34850

ath:AT4G20460

dosa:Os07g0139400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.673

Rank 1 · TkA03G559480 · TK1151

Nucleus0.336

Rank 2 · TkA03G559480 · TK1151

Mitochondrion0.086

Rank 3 · TkA03G559480 · TK1151

Peroxisome0.071

Rank 4 · TkA03G559480 · TK1151

Cell membrane0.049

Rank 5 · TkA03G559480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01370Epimerase2-152 aa

PF010733Beta_HSD3-52 aa

PF04321RmlD_sub_bind8-69 aa

PF16363GDP_Man_Dehyd9-206 aa

PF07993NAD_binding_426-74 aa

PF02719Polysacc_synt_233-71 aa

PF010733Beta_HSD101-140 aa

PF02719Polysacc_synt_2121-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G559480	`PF01370`	Epimerase	2	152	1.6e-24	87.3
TkA03G559480	`PF01073`	3Beta_HSD	3	52	0.0072	16.1
TkA03G559480	`PF04321`	RmlD_sub_bind	8	69	0.00024	21.0
TkA03G559480	`PF16363`	GDP_Man_Dehyd	9	206	2.3e-24	87.2
TkA03G559480	`PF07993`	NAD_binding_4	26	74	0.0004	20.3
TkA03G559480	`PF02719`	Polysacc_synt_2	33	71	0.00021	21.3
TkA03G559480	`PF01073`	3Beta_HSD	101	140	0.0072	16.1
TkA03G559480	`PF02719`	Polysacc_synt_2	121	184	0.00021	21.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUN3`	Arabidopsis thaliana	sp\|Q9SUN3\|ARAE3_ARATH Probable UDP-arabinose 4-epimerase 3	81.900%	Swiss-Prot	High
`Q9SA77`	Arabidopsis thaliana	sp\|Q9SA77\|ARAE1_ARATH UDP-arabinose 4-epimerase 1	81.900%	Swiss-Prot	High
`Q9FI17`	Arabidopsis thaliana	sp\|Q9FI17\|ARAE4_ARATH Putative UDP-arabinose 4-epimerase 4	80.800%	Swiss-Prot	High
`O64749`	Arabidopsis thaliana	sp\|O64749\|ARAE2_ARATH Putative UDP-arabinose 4-epimerase 2	79.000%	Swiss-Prot	High
`Q8H930`	Oryza sativa subsp. japonica	sp\|Q8H930\|ARAE1_ORYSJ Probable UDP-arabinose 4-epimerase 1	79.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card