TkA03G547550 | RubberDandelionOmics

Gene overview

TkA03G547550

Reference: TK1151 Chr: Chr03 Coordinates: 138115720-138118218 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1907 bp · TkA03G547550|TK1151|cDNA

TCCCCATTTTAAATGCATCAAATTCTCCAAATAAACACACACCTCAAAACCCTCTCTTCCCCACCCCCACCCCTCTCTCACACAAACAGTAACCTTTCTTGGTTACACTCCACTACCCATTGTTTTTATTACCCAAAAGAAACAAAGAAACCCTCAAAAAACCACCATTTCAAATCCACACTTTATTTTCTGTTTTCATGAAGAACAATCAAGAAAGAGATAGATAGATAGCCTCACAGCCTCATCTTCTTTTTTCTCTC...

CDS

Download CDS FASTA

1224 bp · TkA03G547550|TK1151|CDS

ATGAAAGGGGAAACATCGTGGGTTAGTCATTGTCTCGACAATATTTCCACCAACAACGAGTTTAATTCGTTCCCAGAAGTCACAGACGACGTTAATAACGACATTTCACCTCTACTACGTGTCGATTTAATCCTCCCCGACGACCTACTCGAAAGAATCCTCGCCTACCTCCCAATCGCAAGCATCTTCCGCGTCGGTTGCGTCTGTAAACGCTGGCACGAAATCGTGAGTTCCCGTCGATTTCTCTGGAACGTCTCTCG...

Protein

Download Protein FASTA

407 aa · TkA03G547550|TK1151|PROTEIN

MKGETSWVSHCLDNISTNNEFNSFPEVTDDVNNDISPLLRVDLILPDDLLERILAYLPIASIFRVGCVCKRWHEIVSSRRFLWNVSRISSQKPWYFMFTSSDDPFGYAYDPVLRKWYEIELPYMVKTSRWFIASSSGLVCFMDNDTRSELYVCNLITKCCFRLHEPPNLRFCDYSALAISVDRVSTSYEVTVVKSRQVPENYFQWDLSIHVYDSVAMTWTTPVTEMLTGWRGGDESVICNGVLYFLIYSTGSFQEHRHGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G547550`
TK1151 ID	TkA03G547550
OH-1004 ID	LXL04_010758
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.700
Protein coverage (%)	TK1151 76.413 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G547550

Location Chr03:138115720-138118218 (+)

Description Similar to At3g61590: F-box/kelch-repeat protein At3g61590

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61590`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g15710`	F-box/kelch-repeat protein At5g15710.	No verified direct reference in this release
`At4g33160`	F-box only protein 13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010758 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009908 flower development Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0035195 miRNA-mediated post-transcriptional gene silencing Biological Process

GO:0060776 simple leaf morphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G27340

ath:AT1G30950

ath:AT3G61590

ath:AT5G15710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.490

Rank 1 · TkA03G547550 · TK1151

Cytoplasm0.386

Rank 2 · TkA03G547550 · TK1151

Cell membrane0.129

Rank 3 · TkA03G547550 · TK1151

Endoplasmic reticulum0.073

Rank 4 · TkA03G547550 · TK1151

Plastid0.064

Rank 5 · TkA03G547550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box44-83 aa

PF12937F-box-like45-84 aa

PF18511F-box_545-57 aa

PF18511F-box_567-75 aa

PF24750b-prop_At3g26010-like99-123 aa

PF18511F-box_5114-120 aa

PF24750b-prop_At3g26010-like131-265 aa

PF07646Kelch_2205-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G547550	`PF00646`	F-box	44	83	5.2e-12	45.9
TkA03G547550	`PF12937`	F-box-like	45	84	4.9e-11	42.9
TkA03G547550	`PF18511`	F-box_5	45	57	0.35	11.2
TkA03G547550	`PF18511`	F-box_5	67	75	0.35	11.2
TkA03G547550	`PF24750`	b-prop_At3g26010-like	99	123	1.7e-11	44.6
TkA03G547550	`PF18511`	F-box_5	114	120	0.35	11.2
TkA03G547550	`PF24750`	b-prop_At3g26010-like	131	265	1.7e-11	44.6
TkA03G547550	`PF07646`	Kelch_2	205	220	0.14	12.9
TkA03G547550	`PF13340`	DUF4096	234	246	0.19	12.7
TkA03G547550	`PF12937`	F-box-like	283	291	4.9e-11	42.9
TkA03G547550	`PF07646`	Kelch_2	288	334	0.14	12.9
TkA03G547550	`PF13340`	DUF4096	302	330	0.19	12.7
TkA03G547550	`PF07646`	Kelch_2	367	379	0.14	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M310`	Arabidopsis thaliana	sp\|Q9M310\|FBK77_ARATH F-box/kelch-repeat protein At3g61590	62.500%	Swiss-Prot	High
`Q9LFV5`	Arabidopsis thaliana	sp\|Q9LFV5\|FK111_ARATH F-box/kelch-repeat protein At5g15710	28.200%	Swiss-Prot	Low
`Q9SMZ3`	Arabidopsis thaliana	sp\|Q9SMZ3\|FBX13_ARATH F-box only protein 13	23.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card