TkA03G537280 | RubberDandelionOmics

Gene overview

TkA03G537280

Reference: TK1151 Chr: Chr03 Coordinates: 135234068-135243307 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2439 bp · TkA03G537280|TK1151|cDNA

ATGGAGTGCCAGGATGAGAACCAACAGATTGCGTACCCCCTGTTTTATGATGTGGCGCCTAGTGACATTCGTTACCAAATTGAGCTAGTTGGAGAAGCAATTGCAAAACATGAGAGTGATGAACAGATTAAGAAATGGGGAAAGGCTCTTGAAAGTGCTGCGAATCTGGTTGGATGGGATCTGAAAAACATTGCTAATGGTGGTGAAAATCTGATAGGCATGGACCGCCGGATGCAAGATGTGGAGTCATTTTTGGGGAT...

CDS

Download CDS FASTA

2439 bp · TkA03G537280|TK1151|CDS

ATGGAGTGCCAGGATGAGAACCAACAGATTGCGTACCCCCTGTTTTATGATGTGGCGCCTAGTGACATTCGTTACCAAATTGAGCTAGTTGGAGAAGCAATTGCAAAACATGAGAGTGATGAACAGATTAAGAAATGGGGAAAGGCTCTTGAAAGTGCTGCGAATCTGGTTGGATGGGATCTGAAAAACATTGCTAATGGTGGTGAAAATCTGATAGGCATGGACCGCCGGATGCAAGATGTGGAGTCATTTTTGGGGAT...

Protein

Download Protein FASTA

812 aa · TkA03G537280|TK1151|PROTEIN

MECQDENQQIAYPLFYDVAPSDIRYQIELVGEAIAKHESDEQIKKWGKALESAANLVGWDLKNIANGGENLIGMDRRMQDVESFLGISLNDKARIIGIKGMGGIGKTSLAKAIFKKVSSHFEGVLNDEHMHVESVYEGERVMKMRLPYKKVLLVLDDVDDAKQLKALAGDWFKDGSRIIVTTRDDKLLLSHGVNAKWIYNVSFLSDEEAMSLFSRYAFKKHMPDEGYEKISSQVVRYADGLPLTIKVLGSNLHGEKELVW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G537280`
TK1151 ID	TkA03G537280
OH-1004 ID	LXL04_010616
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.000
Protein coverage (%)	TK1151 100.000 / OH-1004 77.563 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G537280

Location Chr03:135234068-135243307 (-)

Description Similar to N: TMV resistance protein N

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64070`	TIR-NB-LRR receptor-like protein that confers resistance to the pathogen Leptosphaeria maculans (blackleg disease).	Transgressive segregation reveals two Arabidopsis TIR-NB-LRR resistance genes effective against Leptosphaeria maculans, causal agent of blackleg disease.2006 · DOI: 10.1111/j.1365-313x.2006.02688.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010616 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.399

Rank 1 · TkA03G537280 · TK1151

Cell membrane0.285

Rank 2 · TkA03G537280 · TK1151

Nucleus0.267

Rank 3 · TkA03G537280 · TK1151

Endoplasmic reticulum0.109

Rank 4 · TkA03G537280 · TK1151

Extracellular0.062

Rank 5 · TkA03G537280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582TIR1-68 aa

PF13191AAA_1671-123 aa

PF05970PIF188-126 aa

PF25199nSTAND_NTPase589-185 aa

PF00931NB-ARC90-124 aa

PF20720nSTAND391-165 aa

PF13173AAA_1494-187 aa

PF05729NACHT95-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G537280	`PF01582`	TIR	1	68	1.2e-07	32.4
TkA03G537280	`PF13191`	AAA_16	71	123	0.0075	17.5
TkA03G537280	`PF05970`	PIF1	88	126	0.2	12.0
TkA03G537280	`PF25199`	nSTAND_NTPase5	89	185	0.0037	17.8
TkA03G537280	`PF00931`	NB-ARC	90	124	2.8e-17	63.5
TkA03G537280	`PF20720`	nSTAND3	91	165	0.0072	16.7
TkA03G537280	`PF13173`	AAA_14	94	187	0.0017	19.0
TkA03G537280	`PF05729`	NACHT	95	117	0.018	15.6
TkA03G537280	`PF00004`	AAA	100	161	0.037	15.2
TkA03G537280	`PF00931`	NB-ARC	142	221	2.8e-17	63.5
TkA03G537280	`PF13191`	AAA_16	149	163	0.0075	17.5
TkA03G537280	`PF05729`	NACHT	149	216	0.018	15.6
TkA03G537280	`PF13855`	LRR_8	163	176	3.1e-12	46.8
TkA03G537280	`PF25013`	LRR_Zer-1	270	290	6.1e-05	23.9
TkA03G537280	`PF23598`	LRR_14	273	299	3.1e-38	132.1
TkA03G537280	`PF13855`	LRR_8	274	296	3.1e-12	46.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I594`	Arabidopsis thaliana	sp\|F4I594\|RLM1A_ARATH Disease resistance protein RML1A	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card