TkA03G531840 | RubberDandelionOmics

Gene overview

TkA03G531840

Reference: TK1151 Chr: Chr03 Coordinates: 133752563-133755672 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1964 bp · TkA03G531840|TK1151|cDNA

TTATCATGTGACTTCTCCAGTCCCCTGATCCCCTCTCTTCCCTTCCTCTTCCCCCCAATCATAAGTCATAACCACTCTCTCTCCACCTGTATTTCATCCCTCACTAAAATAAGCTCCATCACCCTCTCCATCAACCCCCAAAACACCCCACACTCCAACACCACTAGGGTTTTCATTTATTACAACCAAAACAGAGTGTTTTTCTTGGAAATTTATGTGAAGAAATCATCGGAAATGGGCTGTTTTCAGTCCAAAACTGC...

CDS

Download CDS FASTA

1719 bp · TkA03G531840|TK1151|CDS

TTATCATGTGACTTCTCCAGTCCCCTGATCCCCTCTCTTCCCTTCCTCTTCCCCCCAATCATAAGTCATAACCACTCTCTCTCCACCTGTATTTCATCCCTCACTAAAATAAGCTCCATCACCCTCTCCATCAACCCCCAAAACACCCCACACTCCAACACCACTAGGGTTTTCATTTATTACAACCAAAACAGAGTGTTTTTCTTGGAAATTTATGTGAAGAAATCATCGGAAATGGGCTGTTTTCAGTCCAAAACTGC...

Protein

Download Protein FASTA

572 aa · TkA03G531840|TK1151|PROTEIN

LSCDFSSPLIPSLPFLFPPIISHNHSLSTCISSLTKISSITLSINPQNTPHSNTTRVFIYYNQNRVFFLEIYVKKSSEMGCFQSKTANVQSPDQVPESKPDPGDGEQGLGQQDQEQAVPSFKEFELTELRAATNGFSSELIVSESGEKAPNVVYRGKLRSNKVVAIKRFSKLSWPDPQQFVAEASGVGKVRHNRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHWDKQPLPWEMRVRVAYHIAQALEHCNSENHKIYH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G531840`
TK1151 ID	TkA03G531840
OH-1004 ID	LXL04_010510
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 85.664 / OH-1004 83.192 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G531840

Location Chr03:133752563-133755672 (-)

Description Similar to BSK2: Serine/threonine-protein kinase BSK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46570`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973
`At4g35230`	Serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973 BR-SIGNALING KINASE1 physically associates with FLAGELLIN SENSING2 and regulates plant innate immunity in Arabidopsis.2013 · DOI: 10.1105/tpc.112.107904
`At5g59010`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	A mutation in Arabidopsis BSK5 encoding a brassinosteroid-signaling kinase protein affects responses to salinity and abscisic acid.2012 · DOI: 10.1016/j.bbrc.2012.08.118
`At3g54030`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0542800`	Probable serine/threonine kinase that functions as a positive regulator of plant immunity.	OsBSK1-2, an Orthologous of AtBSK1, Is Involved in Rice Immunity.2017 · DOI: 10.3389/fpls.2017.00908

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010510 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G54030

ath:AT4G35230

ath:AT5G46570

ath:AT5G59010

dosa:Os04g0684200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.504

Rank 1 · TkA03G531840 · TK1151

Cytoplasm0.273

Rank 2 · TkA03G531840 · TK1151

Nucleus0.240

Rank 3 · TkA03G531840 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA03G531840 · TK1151

Plastid0.053

Rank 5 · TkA03G531840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13174TPR_6111-123 aa

PF07714PK_Tyr_Ser-Thr152-387 aa

PF00069Pkinase152-384 aa

PF25575TPR_BSK1_C423-540 aa

PF13174TPR_6471-491 aa

PF07719TPR_2471-491 aa

PF13174TPR_6502-520 aa

PF07719TPR_2503-526 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G531840	`PF13174`	TPR_6	111	123	0.047	15.1
TkA03G531840	`PF07714`	PK_Tyr_Ser-Thr	152	387	7.5e-27	95.0
TkA03G531840	`PF00069`	Pkinase	152	384	1.4e-25	90.9
TkA03G531840	`PF25575`	TPR_BSK1_C	423	540	5.8e-53	178.5
TkA03G531840	`PF13174`	TPR_6	471	491	0.047	15.1
TkA03G531840	`PF07719`	TPR_2	471	491	0.11	13.4
TkA03G531840	`PF13174`	TPR_6	502	520	0.047	15.1
TkA03G531840	`PF07719`	TPR_2	503	526	0.11	13.4
TkA03G531840	`PF07719`	TPR_2	534	553	0.11	13.4
TkA03G531840	`PF13174`	TPR_6	535	557	0.047	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS26`	Arabidopsis thaliana	sp\|Q9LS26\|BSK2_ARATH Serine/threonine-protein kinase BSK2	78.900%	Swiss-Prot	High
`Q944A7`	Arabidopsis thaliana	sp\|Q944A7\|BSK1_ARATH Serine/threonine-protein kinase BSK1	64.300%	Swiss-Prot	High
`Q9FIL1`	Arabidopsis thaliana	sp\|Q9FIL1\|BSK5_ARATH Serine/threonine-protein kinase BSK5	63.000%	Swiss-Prot	High
`Q9M324`	Arabidopsis thaliana	sp\|Q9M324\|BSK6_ARATH Serine/threonine-protein kinase BSK6	61.600%	Swiss-Prot	High
`Q336V9`	Oryza sativa subsp. japonica	sp\|Q336V9\|BSK12_ORYSJ Serine/threonine-protein kinase BSK1-2	61.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card