TkA03G531110 | RubberDandelionOmics

Gene overview

TkA03G531110

Reference: TK1151 Chr: Chr03 Coordinates: 133541088-133545198 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2355 bp · TkA03G531110|TK1151|cDNA

TTGAAATTGGGGCGGGAAGGGAAGGAGGAGGAACATCTTCTCTTGTACGCTTCAGACCTCCGTCTTCGTATTTTCTGTTTCTGTGCAGTGAAAATGGCTCGAAACAAGGAAGCATTGATCTTATTGATTGATGTTGGTCCATCAATGCACAATGTCTTACCAGAGATTCAAAAAGTCTGTTCTCTACTAATACAAAAGAAGCTGGTTTTCAACAAATATGATGAAGTAGGAGTTGTTGTATTTGGAACAAAAGATACCAA...

CDS

Download CDS FASTA

2205 bp · TkA03G531110|TK1151|CDS

ATGTTTGACTCAAAAAAATACCGAGTGGCGTGGTTGAAATTGGGGCGGGAAGGGAAGGAGGAGGAACATCTTCTCTTGTACGCTTCAGACCTCCGTCTTCGTATTTTCTGTTTCTGTGCAGTGAAAATGGCTCGAAACAAGGTCAACTTCATTTCATTTCCTGTTTTTACAGAAGCATTGATCTTATTGATTGATGTTGGTCCATCAATGCACAATGTCTTACCAGAGATTCAAAAAGTCTGTTCTCTACTAATACAAAA...

Protein

Download Protein FASTA

734 aa · TkA03G531110|TK1151|PROTEIN

MFDSKKYRVAWLKLGREGKEEEHLLLYASDLRLRIFCFCAVKMARNKVNFISFPVFTEALILLIDVGPSMHNVLPEIQKVCSLLIQKKLVFNKYDEVGVVVFGTKDTNNDLMKEVGGYEHVTVLQPIKVVDGDLVDVTQQLPQGTVPGDFMDAIVVGMDMLIKKYQDTIKGKKRICLITDAMYPIKDPYEGTKEDQVYTIAEQMAAHGMKIDCIIFRGHQELNKNNPTIKENDMLLSIFSKKTKAKAVHVETSTSLLGAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G531110`
TK1151 ID	TkA03G531110
OH-1004 ID	LXL04_010498
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.800
Protein coverage (%)	TK1151 96.594 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G531110

Location Chr03:133541088-133545198 (-)

Description Similar to KU80: ATP-dependent DNA helicase 2 subunit KU80

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48050`	Single-stranded DNA-dependent ATP-dependent helicase.	Telomere length deregulation and enhanced sensitivity to genotoxic stress in Arabidopsis mutants deficient in Ku70.2002 · DOI: 10.1093/emboj/21.11.2819 Disruption of the Arabidopsis AtKu80 gene demonstrates an essential role for AtKu80 protein in efficient repair of DNA double-strand breaks in vivo.2002 · DOI: 10.1046/j.1365-313x.2002.01370.x Telomerase dependence of telomere lengthening in Ku80 mutant Arabidopsis.2003 · DOI: 10.1105/tpc.008623 Involvement of KU80 in T-DNA integration in plant cells.2005 · DOI: 10.1073/pnas.0506437103

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0856200`	Single-stranded DNA-dependent ATP-dependent helicase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010498 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000725 recombinational repair Biological Process

GO:0002218 activation of innate immune response Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0009408 response to heat Biological Process

KEGG gene cross-reference

ath:AT1G48050

ddi:DDB_G0286303

dosa:Os03g0856200

mmu:22596

xla:394397

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.727

Rank 1 · TkA03G531110 · TK1151

Cytoplasm0.319

Rank 2 · TkA03G531110 · TK1151

Mitochondrion0.047

Rank 3 · TkA03G531110 · TK1151

Cell membrane0.039

Rank 4 · TkA03G531110 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA03G531110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03731Ku_N59-186 aa

PF17832Pre-PUA220-255 aa

PF02735Ku280-483 aa

PF03730Ku_C504-581 aa

PF17832Pre-PUA559-589 aa

PF08785Ku_PK_bind615-729 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G531110	`PF03731`	Ku_N	59	186	8.9e-10	39.4
TkA03G531110	`PF17832`	Pre-PUA	220	255	0.14	13.5
TkA03G531110	`PF02735`	Ku	280	483	1.3e-43	149.8
TkA03G531110	`PF03730`	Ku_C	504	581	7.3e-08	33.6
TkA03G531110	`PF17832`	Pre-PUA	559	589	0.14	13.5
TkA03G531110	`PF08785`	Ku_PK_bind	615	729	2.9e-33	115.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FQ09`	Arabidopsis thaliana	sp\|Q9FQ09\|KU80_ARATH ATP-dependent DNA helicase 2 subunit KU80	59.200%	Swiss-Prot	High
`Q75IP6`	Oryza sativa subsp. japonica	sp\|Q75IP6\|KU80_ORYSJ ATP-dependent DNA helicase 2 subunit KU80	59.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card