LXL04_010498 | RubberDandelionOmics

Gene overview

LXL04_010498

Reference: OH-1004 Chr: Chr02 Coordinates: 147785972-147789988 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2142 bp · LXL04_010498|LXL04_010498|OH1004|cDNA

TTGAAATAGGGGCGGGAAGGGAAGGAGGAGGAACATCTTCTCTTGTACGCTTCAGACCTCCGTCTTCGTATTTTCTGTTTCTGTGAAGAGAAAATGGCTCGAAACAAGGAAGCATTGATCTTATTGATTGATGTTGGTCCATCAATGCACAATGTCTTACCAGAGATTCAAAAAGTCTGTTCTCTACTAATACAAAAGAAGCTGGTTTTCAACAAATATGATGAAGTAGGAGTTGTTGTATTTGGAACAAAAGATACCAA...

CDS

Download CDS FASTA

2100 bp · LXL04_010498|LXL04_010498|OH1004|CDS

TTGTACGCTTCAGACCTCCGTCTTCGTATTTTCTGTTTCTGTGAAGAGAAAATGGCTCGAAACAAGGAAGCATTGATCTTATTGATTGATGTTGGTCCATCAATGCACAATGTCTTACCAGAGATTCAAAAAGTCTGTTCTCTACTAATACAAAAGAAGCTGGTTTTCAACAAATATGATGAAGTAGGAGTTGTTGTATTTGGAACAAAAGATACCAACAATGATTTGATGAAAGAAGTTGGTGGATATGAACACGTGAC...

Protein

Download Protein FASTA

699 aa · LXL04_010498|LXL04_010498|OH1004|PROTEIN

MYASDLRLRIFCFCEEKMARNKEALILLIDVGPSMHNVLPEIQKVCSLLIQKKLVFNKYDEVGVVVFGTKDTNNDLMKEVGGYEHVTVLQPIKVVDGDLVDVTQQLPQGTVPGDFMDAIVVGMDMLIKKYQDTIKGKKRICLITDAMYPIKDPYEGTKEDQVYTIAEQMAAHGMKIDCIIFRGHQELNKNNPTIKENDMLLSIFSKKTKAKAVHVETSTSLLGALRTRNLAPVTTFRGDLELSPTCKIKIWVYKKTSEEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010498`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010498

Location Chr02:147785972-147789988 (-)

Description Similar to KU80: ATP-dependent DNA helicase 2 subunit KU80

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48050`	Single-stranded DNA-dependent ATP-dependent helicase.	Telomere length deregulation and enhanced sensitivity to genotoxic stress in Arabidopsis mutants deficient in Ku70.2002 · DOI: 10.1093/emboj/21.11.2819 Disruption of the Arabidopsis AtKu80 gene demonstrates an essential role for AtKu80 protein in efficient repair of DNA double-strand breaks in vivo.2002 · DOI: 10.1046/j.1365-313x.2002.01370.x Telomerase dependence of telomere lengthening in Ku80 mutant Arabidopsis.2003 · DOI: 10.1105/tpc.008623 Involvement of KU80 in T-DNA integration in plant cells.2005 · DOI: 10.1073/pnas.0506437103

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0856200`	Single-stranded DNA-dependent ATP-dependent helicase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010498 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000725 recombinational repair Biological Process

GO:0002218 activation of innate immune response Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0009408 response to heat Biological Process

KEGG gene cross-reference

ath:AT1G48050

ddi:DDB_G0286303

dosa:Os03g0856200

mmu:22596

xla:394397

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.749

Rank 1 · LXL04_010498 · OH-1004

Cytoplasm0.319

Rank 2 · LXL04_010498 · OH-1004

Mitochondrion0.043

Rank 3 · LXL04_010498 · OH-1004

Cell membrane0.037

Rank 4 · LXL04_010498 · OH-1004

Endoplasmic reticulum0.029

Rank 5 · LXL04_010498 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03731.22Ku_N24-151 aa

PF02735.23Ku245-448 aa

PF03730.20Ku_C469-546 aa

PF08785.17Ku_PK_bind580-694 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010498	`PF03731.22`	Ku_N	24	151	7.4e-10	39.6
LXL04_010498	`PF02735.23`	Ku	245	448	6e-44	150.9
LXL04_010498	`PF03730.20`	Ku_C	469	546	2e-07	32.2
LXL04_010498	`PF08785.17`	Ku_PK_bind	580	694	3.7e-33	115.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FQ09`	Arabidopsis thaliana	ATP-dependent DNA helicase 2 subunit KU80	58.712%	Swiss-Prot	strong database homology
`Q75IP6`	Oryza sativa subsp. japonica	ATP-dependent DNA helicase 2 subunit KU80	59.249%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card