TkA03G525950 | RubberDandelionOmics

Gene overview

TkA03G525950

Reference: TK1151 Chr: Chr03 Coordinates: 132031989-132032796 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · TkA03G525950|TK1151|cDNA

ATGCTGATTCTGAAATGGAGTCTGAAGAATGTGAATTCATGGATCTACGAGAGGCATTTTGGGAAGGAGAAGAAGGAATGTCTGCCACCAGGTGATTTGGGTTGGCCGTTCATCGGGAACATGTGGTCTTTCCTCAGAGCTTTCAAGTCTAGTGACCCTGATGCCTTCATCTCCAATTCCTTCACAGATAGATTCGGATCAAAGGGTTTATACAAGACGTTAATGTTCGGTAGCCCTAGCATCATCGTTACTATTCCTGA...

CDS

Download CDS FASTA

387 bp · TkA03G525950|TK1151|CDS

ATGCTGATTCTGAAATGGAGTCTGAAGAATGTGAATTCATGGATCTACGAGAGGCATTTTGGGAAGGAGAAGAAGGAATGTCTGCCACCAGGTGATTTGGGTTGGCCGTTCATCGGGAACATGTGGTCTTTCCTCAGAGCTTTCAAGTCTAGTGACCCTGATGCCTTCATCTCCAATTCCTTCACAGATAGATTCGGATCAAAGGGTTTATACAAGACGTTAATGTTCGGTAGCCCTAGCATCATCGTTACTATTCCTGA...

Protein

Download Protein FASTA

128 aa · TkA03G525950|TK1151|PROTEIN

MLILKWSLKNVNSWIYERHFGKEKKECLPPGDLGWPFIGNMWSFLRAFKSSDPDAFISNSFTDRFGSKGLYKTLMFGSPSIIVTIPDVCWKILLDDNAFKPGWPTATLELIGRKSFIGISSVEHQKAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G525950`
TK1151 ID	TkA03G525950
OH-1004 ID	LXL04_010512
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.000
Protein coverage (%)	TK1151 98.438 / OH-1004 38.564 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G525950

Location Chr03:132031989-132032796 (-)

Description Similar to KAO1: Ent-kaurenoic acid oxidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05160`	Catalyzes three successive oxidations of ent-kaurenoic acid giving gibberellin 12 (GA12), a key step in gibberellins (GAs) biosynthesis.	No verified direct reference in this release
`At2g32440`	Catalyzes three successive oxidations of ent-kaurenoic acid giving gibberellin 12 (GA12), a key step in gibberellins (GAs) biosynthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0110000`	Involved in gibberellin (GA) biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010512 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009685 gibberellin metabolic process Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0048868 pollen tube development Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0020037 heme binding Molecular Function

GO:0051777 ent-kaurenoic acid monooxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05160

ath:AT2G32440

dosa:Os06g0110000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.869

Rank 1 · TkA03G525950 · TK1151

Cytoplasm0.049

Rank 2 · TkA03G525950 · TK1151

Golgi apparatus0.049

Rank 3 · TkA03G525950 · TK1151

Nucleus0.032

Rank 4 · TkA03G525950 · TK1151

Plastid0.029

Rank 5 · TkA03G525950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23051`	Arabidopsis thaliana	sp\|O23051\|KAO1_ARATH Ent-kaurenoic acid oxidase 1	62.600%	Swiss-Prot	High
`Q9C5Y2`	Arabidopsis thaliana	sp\|Q9C5Y2\|KAO2_ARATH Ent-kaurenoic acid oxidase 2	59.500%	Swiss-Prot	High
`Q5VRM7`	Oryza sativa subsp. japonica	sp\|Q5VRM7\|KAO_ORYSJ Ent-kaurenoic acid oxidase	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card