TkA03G525620 | RubberDandelionOmics

Gene overview

TkA03G525620

Reference: TK1151 Chr: Chr03 Coordinates: 131926987-131927490 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA03G525620|TK1151|cDNA

ATGGCTCAGAGAACGGAGAAAGAAGAGACAGAATTCAAGGTTGTGCCGGAAACGCTGACTCTGACGACCGCGAGCTCGACGACGTCGCAACGTATTCGTAGCAGATCCAGCTCGTTCCGGTCGACGTCTCCTCGCGCAGTATCGGTAGATCTGGTGGTGGATCGGACGGTTGTGGTGGTAAATGAAGAATTAAAGGAGACGGAGAAGACGGAGACGGTGGTGGTGGTGGTGAAGAAGGAGGTGAGTCGATGCTCTGGATG...

CDS

Download CDS FASTA

432 bp · TkA03G525620|TK1151|CDS

ATGGCTCAGAGAACGGAGAAAGAAGAGACAGAATTCAAGGTTGTGCCGGAAACGCTGACTCTGACGACCGCGAGCTCGACGACGTCGCAACGTATTCGTAGCAGATCCAGCTCGTTCCGGTCGACGTCTCCTCGCGCAGTATCGGTAGATCTGGTGGTGGATCGGACGGTTGTGGTGGTAAATGAAGAATTAAAGGAGACGGAGAAGACGGAGACGGTGGTGGTGGTGGTGAAGAAGGAGGTGAGTCGATGCTCTGGATG...

Protein

Download Protein FASTA

143 aa · TkA03G525620|TK1151|PROTEIN

MAQRTEKEETEFKVVPETLTLTTASSTTSQRIRSRSSSFRSTSPRAVSVDLVVDRTVVVVNEELKETEKTETVVVVVKKEVSRCSGCRKRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARDNPVVKAAKIVRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G525620`
TK1151 ID	TkA03G525620
OH-1004 ID	LXL04_010399
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G525620

Location Chr03:131926987-131927490 (+)

Description Similar to SAP5: Zinc finger A20 and AN1 domain-containing stress-associated protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12630`	May be involved in environmental stress response.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z2J6`	May be involved in environmental stress response.	No verified direct reference in this release
`Os09g0486500`	May be involved in environmental stress response.	No verified direct reference in this release
`Os08g0504700`	May be involved in environmental stress response.	No verified direct reference in this release
`Os05g0299700`	May be involved in environmental stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010399 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G12630

dosa:Os02g0195600

dosa:Os08g0504700

dosa:Os09g0486500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.773

Rank 1 · TkA03G525620 · TK1151

Cytoplasm0.295

Rank 2 · TkA03G525620 · TK1151

Mitochondrion0.031

Rank 3 · TkA03G525620 · TK1151

Cell membrane0.024

Rank 4 · TkA03G525620 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA03G525620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19266CIS_tube5-80 aa

PF02565RecO_C5-25 aa

PF02565RecO_C81-131 aa

PF01428zf-AN184-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G525620	`PF19266`	CIS_tube	5	80	0.00032	21.2
TkA03G525620	`PF02565`	RecO_C	5	25	0.09	13.2
TkA03G525620	`PF02565`	RecO_C	81	131	0.09	13.2
TkA03G525620	`PF01428`	zf-AN1	84	121	4.5e-10	40.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHJ8`	Arabidopsis thaliana	sp\|Q9LHJ8\|SAP5_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 5	52.800%	Swiss-Prot	High
`A2Z2J6`	Oryza sativa subsp. indica	sp\|A2Z2J6\|SAP1_ORYSI Zinc finger A20 and AN1 domain-containing stress-associated protein 1	85.500%	Swiss-Prot	Low
`A3C039`	Oryza sativa subsp. japonica	sp\|A3C039\|SAP1_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 1	85.500%	Swiss-Prot	Low
`Q84PD8`	Oryza sativa subsp. japonica	sp\|Q84PD8\|SAP11_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 11	77.400%	Swiss-Prot	Low
`Q0DJC7`	Oryza sativa subsp. japonica	sp\|Q0DJC7\|SAP15_ORYSJ Zinc finger AN1 domain-containing stress-associated protein 15	73.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card