LXL04_010399 | RubberDandelionOmics

Gene overview

LXL04_010399

Reference: OH-1004 Chr: Chr02 Coordinates: 146047174-146047677 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · LXL04_010399|LXL04_010399|OH1004|cDNA

ATGGCTCAGAGAACGGAGAAAGAAGAGACAGAATTCAAGGTTGTGCCGGAAACGCTGACTCTGTGCGTTAACAACTGCGGCGTCGTTGGGAATCCGGCGAACAACAATATGTGTCAGAAGTGTTTCAATTCAACGACGACCGCGAGCTCGACGACGTCGCAACGTATTCGTAGCAGATCCAGCTCGTTCCGGTCGACGTCTCCTCGCGCAGTATCGGTAGATCTGGTGGTGGATCGGACGGTTGTGGTGGTAAATGAAGA...

CDS

Download CDS FASTA

504 bp · LXL04_010399|LXL04_010399|OH1004|CDS

ATGGCTCAGAGAACGGAGAAAGAAGAGACAGAATTCAAGGTTGTGCCGGAAACGCTGACTCTGTGCGTTAACAACTGCGGCGTCGTTGGGAATCCGGCGAACAACAATATGTGTCAGAAGTGTTTCAATTCAACGACGACCGCGAGCTCGACGACGTCGCAACGTATTCGTAGCAGATCCAGCTCGTTCCGGTCGACGTCTCCTCGCGCAGTATCGGTAGATCTGGTGGTGGATCGGACGGTTGTGGTGGTAAATGAAGA...

Protein

Download Protein FASTA

167 aa · LXL04_010399|LXL04_010399|OH1004|PROTEIN

MAQRTEKEETEFKVVPETLTLCVNNCGVVGNPANNNMCQKCFNSTTTASSTTSQRIRSRSSSFRSTSPRAVSVDLVVDRTVVVVNEELKETEKTETVVVVVKKEVSRCSGCRKRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARDNPVVKAAKIVRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010399`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010399

Location Chr02:146047174-146047677 (+)

Description Similar to SAP5: Zinc finger A20 and AN1 domain-containing stress-associated protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12630`	May be involved in environmental stress response.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0486500`	May be involved in environmental stress response.	No verified direct reference in this release
`UniProt: A2Z2J6`	May be involved in environmental stress response.	No verified direct reference in this release
`Os08g0504700`	May be involved in environmental stress response.	No verified direct reference in this release
`Os02g0195600`	May be involved in environmental stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010399 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G12630

dosa:Os02g0195600

dosa:Os08g0504700

dosa:Os09g0486500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.861

Rank 1 · LXL04_010399 · OH-1004

Cytoplasm0.252

Rank 2 · LXL04_010399 · OH-1004

Mitochondrion0.028

Rank 3 · LXL04_010399 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_010399 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_010399 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01754.24zf-A2021-45 aa

PF01428.24zf-AN1108-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010399	`PF01754.24`	zf-A20	21	45	2e-10	40.8
LXL04_010399	`PF01428.24`	zf-AN1	108	145	8.6e-10	39.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHJ8`	Arabidopsis thaliana	Zinc finger A20 and AN1 domain-containing stress-associated protein 5	54.971%	Swiss-Prot	strong database homology
`A3C039`	Oryza sativa subsp. japonica	Zinc finger A20 and AN1 domain-containing stress-associated protein 1	49.701%	Swiss-Prot	moderate database homology
`A2Z2J6`	Oryza sativa subsp. indica	Zinc finger A20 and AN1 domain-containing stress-associated protein 1	49.701%	Swiss-Prot	moderate database homology
`Q84PD8`	Oryza sativa subsp. japonica	Zinc finger A20 and AN1 domain-containing stress-associated protein 11	46.199%	Swiss-Prot	moderate database homology
`Q6H7P8`	Oryza sativa subsp. japonica	Zinc finger A20 and AN1 domain-containing stress-associated protein 4	42.945%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card