TkA03G519600 | RubberDandelionOmics

Gene overview

TkA03G519600

Reference: TK1151 Chr: Chr03 Coordinates: 130361371-130364286 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1644 bp · TkA03G519600|TK1151|cDNA

CAACAGGCCACAGCTCTTGCCCCGAAAGTCTTCTCTCTCTCATCAAAAAGTGATTTTATATATAAGTAAAGGGAATTGTAGCAAACCCACAAAATATTCAAATCAAAATCTCTCTTTTGTATGTAATCTTTCCAAGAATACAACAACTAAAAATGGCTGATTCTTCTTCTTCCTCATCAACTTGGCATCAAGTCTATGTGAAGCTCAGATTCTTTTCCAGAATTCGACGCTTACTCGCCAACAAGACCTCCTCCGGTAAC...

CDS

Download CDS FASTA

1296 bp · TkA03G519600|TK1151|CDS

ATGGCTGATTCTTCTTCTTCCTCATCAACTTGGCATCAAGTCTATGTGAAGCTCAGATTCTTTTCCAGAATTCGACGCTTACTCGCCAACAAGACCTCCTCCGGTAACAAGCGGTCCTCCGATCAGTCTGCCGACGGAAGAACCACAGAGATATTGGTCGGCGATCAAGGAGGGAGAACCGAAAGTATTAACCATGGTGATGATGATGATGATGATTCTGGAATTTTACAGAAGTCTGTGAAGAAGCTACACTTTGGGAA...

Protein

Download Protein FASTA

431 aa · TkA03G519600|TK1151|PROTEIN

MADSSSSSSTWHQVYVKLRFFSRIRRLLANKTSSGNKRSSDQSADGRTTEILVGDQGGRTESINHGDDDDDDSGILQKSVKKLHFGNLEEKAAAAKEIKRLAGDDLKRRKLMADLGVIPPLVAMLSSEYSPTHRRLAVQALLELANGTCTNKALMMEAGILSKLSESIGVEELANHEFAQLVMSLSSLVNAQFPIDSSKILPLALHMLKLDSSKDTKILCLGTLYNLSTVIDNVGSLATKEVVETLLKLSSMKEASEKAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G519600`
TK1151 ID	TkA03G519600
OH-1004 ID	LXL04_010330
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G519600`
Location	Chr03:130361371-130364286 (-)
Description	Similar to PUB7: U-box domain-containing protein 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010330` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016567 protein ubiquitination Biological Process GO:0031648 protein destabilization Biological Process GO:0051865 protein autoubiquitination Biological Process GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function GO:0070696 transmembrane receptor protein serine/threonine kinase binding Molecular Function
KEGG gene cross-reference	ath:AT1G24330 ath:AT1G27910 ath:AT1G67530 ath:AT1G71020 ath:AT3G54790 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.379

Rank 1 · TkA03G519600 · TK1151

Nucleus0.352

Rank 2 · TkA03G519600 · TK1151

Cell membrane0.317

Rank 3 · TkA03G519600 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA03G519600 · TK1151

Golgi apparatus0.044

Rank 5 · TkA03G519600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25598ARM_PUB75-166 aa

PF13646HEAT_297-144 aa

PF00514Arm109-138 aa

PF24768ARM_ARMC5112-249 aa

PF26524ARM_7113-166 aa

PF02985HEAT117-145 aa

PF00514Arm151-164 aa

PF08324PUL176-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G519600	`PF25598`	ARM_PUB	75	166	3.5e-05	24.1
TkA03G519600	`PF13646`	HEAT_2	97	144	0.0029	18.6
TkA03G519600	`PF00514`	Arm	109	138	1.7e-06	28.6
TkA03G519600	`PF24768`	ARM_ARMC5	112	249	6e-08	33.1
TkA03G519600	`PF26524`	ARM_7	113	166	0.026	14.6
TkA03G519600	`PF02985`	HEAT	117	145	0.2	12.7
TkA03G519600	`PF00514`	Arm	151	164	1.7e-06	28.6
TkA03G519600	`PF08324`	PUL	176	276	0.011	15.8
TkA03G519600	`PF00514`	Arm	198	228	1.7e-06	28.6
TkA03G519600	`PF02985`	HEAT	200	230	0.2	12.7
TkA03G519600	`PF13646`	HEAT_2	230	251	0.0029	18.6
TkA03G519600	`PF24768`	ARM_ARMC5	240	333	6e-08	33.1
TkA03G519600	`PF25598`	ARM_PUB	241	358	3.5e-05	24.1
TkA03G519600	`PF00514`	Arm	246	267	1.7e-06	28.6
TkA03G519600	`PF13646`	HEAT_2	300	355	0.0029	18.6
TkA03G519600	`PF00514`	Arm	324	331	1.7e-06	28.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card