LXL04_010330 | RubberDandelionOmics

Gene overview

LXL04_010330

Reference: OH-1004 Chr: Chr02 Coordinates: 144337742-144340309 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1296 bp · LXL04_010330|LXL04_010330|OH1004|cDNA

ATGGCtgattcttcttcttcctcatcAACTTGGCATCAAGTCTATGTGAAGCTCAGATTCTTTTCCAGAATTCGACGCTTACTCGCCAACAAGACCTCCTCCGGCAACAAGCGGTCCTCCGATCAGTCTCCCGACGGAAGAACCACAGAGATATTGGTCGGCGATCAAGGAGGGAGAACTGAAAGTATTAACcatggtgatgatgatgatgatgattctgGAATTTTACAGAAGTCTGTGAAGAAGCTACACTTTGGGAA...

CDS

Download CDS FASTA

1296 bp · LXL04_010330|LXL04_010330|OH1004|CDS

ATGGCTGATTCTTCTTCTTCCTCATCAACTTGGCATCAAGTCTATGTGAAGCTCAGATTCTTTTCCAGAATTCGACGCTTACTCGCCAACAAGACCTCCTCCGGCAACAAGCGGTCCTCCGATCAGTCTCCCGACGGAAGAACCACAGAGATATTGGTCGGCGATCAAGGAGGGAGAACTGAAAGTATTAACCATGGTGATGATGATGATGATGATTCTGGAATTTTACAGAAGTCTGTGAAGAAGCTACACTTTGGGAA...

Protein

Download Protein FASTA

431 aa · LXL04_010330|LXL04_010330|OH1004|PROTEIN

MADSSSSSSTWHQVYVKLRFFSRIRRLLANKTSSGNKRSSDQSPDGRTTEILVGDQGGRTESINHGDDDDDDSGILQKSVKKLHFGNLEEKAAAAKEIKRLAGDDLKRRKLMADLGVIPPLVAMLSSEYSPTHRRLAVQALLELANGTCTNKALMMEAGILSKLSESIGVEELANHEFAQLVMSLSSLVNAQFPIDSSKILPLALHMLKLDSSKDTKILCLGTLYNLSTVIDNVGSLATKEVVETLLKLSSMKEASEKAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010330`
TK1151 ID	TkA03G519600
OH-1004 ID	LXL04_010330
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010330

Location Chr02:144337742-144340309 (-)

Description Similar to PUB7: U-box domain-containing protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67530`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g27910`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g24330`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At3g54790`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g71020`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010330 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0031648 protein destabilization Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0070696 transmembrane receptor protein serine/threonine kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G24330

ath:AT1G27910

ath:AT1G67530

ath:AT1G71020

ath:AT3G54790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.378

Rank 1 · LXL04_010330 · OH-1004

Nucleus0.350

Rank 2 · LXL04_010330 · OH-1004

Cell membrane0.321

Rank 3 · LXL04_010330 · OH-1004

Endoplasmic reticulum0.072

Rank 4 · LXL04_010330 · OH-1004

Golgi apparatus0.043

Rank 5 · LXL04_010330 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAG5`	Arabidopsis thaliana	U-box domain-containing protein 7	29.930%	Swiss-Prot	weak database homology
`Q9C7G1`	Arabidopsis thaliana	U-box domain-containing protein 45	29.577%	Swiss-Prot	weak database homology
`O48700`	Arabidopsis thaliana	U-box domain-containing protein 6	26.797%	Swiss-Prot	weak database homology
`Q8GWV5`	Arabidopsis thaliana	U-box domain-containing protein 3	29.139%	Swiss-Prot	weak database homology
`Q9C9A6`	Arabidopsis thaliana	U-box domain-containing protein 10	25.329%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card