TkA03G518280 | RubberDandelionOmics

Gene overview

TkA03G518280

Reference: TK1151 Chr: Chr03 Coordinates: 130008886-130014425 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2501 bp · TkA03G518280|TK1151|cDNA

ATGATCAAGAAATTGATTCTTCCACGATCCCCAAAGGGATTTCCAAAGAAACAGTCAGTGAAGGGATTGAACGATCTTCTCTTGGAGCCAATTGAATGTAATCGTGGACGGTACGGCGTTTTTGGAAGACAAATAGAACCATTGTTGAGCGATGGTGGTATTCGACCTCAACCACCGTCATCTTCCAAGAAAGTCATTGGAGAAGGAGTTTTGTTTCATCTTTTCATCATCTCGACGCGGCTCCCTACTTCCCTGCCTCT...

CDS

Download CDS FASTA

2229 bp · TkA03G518280|TK1151|CDS

ATGATCAAGAAATTGATTCTTCCACGATCCCCAAAGGGATTTCCAAAGAAACAGTCAGTGAAGGGATTGAACGATCTTCTCTTGGAGCCAATTGAATGTAATCGTGGACGGTACGGCGTTTTTGGAAGACAAATAGAACCATTGTTGAGCGATGGTGGTATTCGACCTCAACCACCGTCATCTTCCAAGAAAGTCATTGGAGAAGGAGTTTTGTTTCATCTTTTCATCATCTCGACGCGGCTCCCTACTTCCCTGCCTCT...

Protein

Download Protein FASTA

742 aa · TkA03G518280|TK1151|PROTEIN

MIKKLILPRSPKGFPKKQSVKGLNDLLLEPIECNRGRYGVFGRQIEPLLSDGGIRPQPPSSSKKVIGEGVLFHLFIISTRLPTSLPLSSIYCHRSGRSTSSICYTENDCILTALPNRKPNSSCCHRSLTTLLLLAAVSLSCDAGDRSTGKANRSLRSSYRRLICLLSPSSVAGSSFPVAIYSKSSQKLETYRNVDVVILTKSIPYLKDLNHYFGQAGMDNSWKQRELVFLLLYAAIFYIVIIHYSLQLSHDNYNKLYGLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G518280`
TK1151 ID	TkA03G518280
OH-1004 ID	LXL04_010304
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.400
Protein coverage (%)	TK1151 82.345 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G518280`
Location	Chr03:130008886-130014425 (+)
Description	Similar to SPAC24H6.01c: Putative membrane-bound O-acyltransferase C24H6.01c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010304` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006506 GPI anchor biosynthetic process Biological Process GO:0009267 cellular response to starvation Biological Process GO:0015793 glycerol transmembrane transport Biological Process GO:0019563 glycerol catabolic process Biological Process GO:0030447 filamentous growth Biological Process GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation Biological Process GO:0036180 filamentous growth of a population of unicellular organisms in response to biotic stimulus Biological Process GO:0044011 single-species biofilm formation on inanimate substrate Biological Process GO:0071475 cellular hyperosmotic salinity response Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	cal:CAALFM_C113540WA sce:YGL084C sce:YPL189W spo:2541508 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.696

Rank 1 · TkA03G518280 · TK1151

Nucleus0.126

Rank 2 · TkA03G518280 · TK1151

Golgi apparatus0.106

Rank 3 · TkA03G518280 · TK1151

Cytoplasm0.096

Rank 4 · TkA03G518280 · TK1151

Cell membrane0.085

Rank 5 · TkA03G518280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03062MBOAT378-656 aa

PF12591DUF3762412-452 aa

PF12591DUF3762653-676 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G518280	`PF03062`	MBOAT	378	656	3.1e-39	135.9
TkA03G518280	`PF12591`	DUF3762	412	452	0.086	13.8
TkA03G518280	`PF12591`	DUF3762	653	676	0.086	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card