RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_010304
Reference: OH-1004 Chr: Chr02 Coordinates: 143925468-143929426 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1951 bp · LXL04_010304|LXL04_010304|OH1004|cDNA

ATAGATAAGTTAATTTGCAAAATAGATTCTACCTTTCACACACAGACGCAAAACACACGTCGCTAGTCGCCTCACTCCCCTCCTGCTGGTCGCTGCTCTCTCCCTCTCCTGTGACGCCGGCGATCGCACCACCGGAAAAGCGAACCGCAGTCGGCAGTCTTCCTATCGCCGTCTGATCTGCTTGCTGTCTTCCTCTTCAGTCGCCGGCTCTTCCTTTCCTGTCGCCATCTGCTCCAAGAGATCAATGTCATGGAACTCAC...

CDS

Download CDS FASTA

1869 bp · LXL04_010304|LXL04_010304|OH1004|CDS

CTGCTGGTCGCTGCTCTCTCCCTCTCCTGTGACGCCGGCGATCGCACCACCGGAAAAGCGAACCGCAGTCGGCAGTCTTCCTATCGCCGTCTGATCTGCTTGCTGTCTTCCTCTTCAGTCGCCGGCTCTTCCTTTCCTGTCGCCATCTGCTCCAAGAGATCAATGTCATGGAACTCACGTCTTCCAGGCTATGGAACAGATACAGATTATATGCCCTTTTTGTATCTGAAGGATTTAAATCACTATTTTGGACAAGTTGG...

Protein

Download Protein FASTA

622 aa · LXL04_010304|LXL04_010304|OH1004|PROTEIN

MLVAALSLSCDAGDRTTGKANRSRQSSYRRLICLLSSSSVAGSSFPVAICSKRSMSWNSRLPGYGTDTDYMPFLYLKDLNHYFGQVGMNNSWKQRELVFLLLYAAIFYIVIIHYSLQLSHDNHNKLYGLRPGLISNQLNDASDAQWRNFRSNLSILTFVFGLFTLIANTTRAFFDLKSDGMSIVWLLISLAYLSYLHGAFIFFILAITSTNFILVKIFGRSKYFPFILWVFNLSFLLCNRVYEGYSFASFGDSWAYLDKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_010304
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_010304
LocationChr02:143925468-143929426 (+)
DescriptionSimilar to SPAC24H6.01c: Putative membrane-bound O-acyltransferase C24H6.01c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010304 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006506 GPI anchor biosynthetic process Biological Process
GO:0009267 cellular response to starvation Biological Process
GO:0015793 glycerol transmembrane transport Biological Process
GO:0019563 glycerol catabolic process Biological Process
GO:0030447 filamentous growth Biological Process
GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation Biological Process
GO:0036180 filamentous growth of a population of unicellular organisms in response to biotic stimulus Biological Process
GO:0044011 single-species biofilm formation on inanimate substrate Biological Process
GO:0071475 cellular hyperosmotic salinity response Biological Process
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005829 cytosol Cellular Component
KEGG gene cross-reference
cal:CAALFM_C113540WA
sce:YGL084C
sce:YPL189W
spo:2541508
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.799
Rank 1 · LXL04_010304 · OH-1004
Nucleus0.106
Rank 2 · LXL04_010304 · OH-1004
Cytoplasm0.075
Rank 3 · LXL04_010304 · OH-1004
Golgi apparatus0.069
Rank 4 · LXL04_010304 · OH-1004
Cell membrane0.057
Rank 5 · LXL04_010304 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03062.25MBOAT263-536 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_010304PF03062.25MBOAT2635366.1e-39135.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser