TkA03G518250 | RubberDandelionOmics

Gene overview

TkA03G518250

Reference: TK1151 Chr: Chr03 Coordinates: 129991565-130000096 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1986 bp · TkA03G518250|TK1151|cDNA

TGATGCTATTTGAGGATAGAAACACTAAGATTTGCAGTTTTTATGACTCCAAAATCCGAAGAAAAATTTCCAAACACATATCCAAACAGTCCAATTCGGACCATAATACGAGATAATGATCAAAGAAACATACATGACGTTATTCTAGAATAGAAACTTTGAAACAAAGCATCTTAGACTCTTAAATTGGAAGGACATATATAATATACTAAACCCGAAGTATGTTACGATATTAAAAATGATGTGTTGTCATTTGGTTG...

CDS

Download CDS FASTA

1692 bp · TkA03G518250|TK1151|CDS

ATGGGCGACTCCACCGCCAGGGATGGCGGTGATAAAACCTTGTCGGAGAGAAACGTCGCTGAAGAAGTGTCTAGGCTTGTGGAACAAAGTAAAGAGTTGCAGGAATCAGCATCGACCTTAATTTCTAGAAATTCGCAGGAGGAATCATCGCTACGGCAACGTGCCGTAACTCTCGATTCAGATATCAAAAAGCTCCGAACGTTCATAGGTTCCTCCGTCAAGAAAGGCAATTTAGATTCCAAACACGAAGAAAAATTAGG...

Protein

Download Protein FASTA

563 aa · TkA03G518250|TK1151|PROTEIN

MGDSTARDGGDKTLSERNVAEEVSRLVEQSKELQESASTLISRNSQEESSLRQRAVTLDSDIKKLRTFIGSSVKKGNLDSKHEEKLGEELSRASYTLGEGDAATFLPCKSHGRFLRMLLGPINVRANRQDIQLKVKEEYYSFRDRTAYLFLFFPSLLLVLRSSVWDGCFPALPVQIYQAWLLFLYTGLALRENILRVNGSDIRPWWIYHHYFAMAMALISLTWEIERQPDCSQKQKGIQLFLRWAIMQGVAMLLQNRYQR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G518250`
TK1151 ID	TkA03G518250
OH-1004 ID	LXL04_010299
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 97.079 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G518250

Location Chr03:129991565-130000096 (+)

Description Similar to NUDT15: Nudix hydrolase 15, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28960`	Coenzyme A diphosphatase which mediates the cleavage of oxidized CoA.	No verified direct reference in this release
`At5g45940`	Coenzyme A diphosphatase which mediates the cleavage of CoA into 3',5'-ADP from CoA and 4'-phosphopantetheine.	No verified direct reference in this release
`At2g33980`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010299 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006104 succinyl-CoA metabolic process Biological Process

GO:0006637 acyl-CoA metabolic process Biological Process

GO:0006753 nucleoside phosphate metabolic process Biological Process

GO:0009132 nucleoside diphosphate metabolic process Biological Process

GO:0015937 coenzyme A biosynthetic process Biological Process

GO:0015938 coenzyme A catabolic process Biological Process

GO:0036114 medium-chain fatty-acyl-CoA catabolic process Biological Process

GO:0044580 butyryl-CoA catabolic process Biological Process

GO:0046356 acetyl-CoA catabolic process Biological Process

GO:1901289 succinyl-CoA catabolic process Biological Process

GO:1902858 propionyl-CoA metabolic process Biological Process

GO:1902859 propionyl-CoA catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G28960

ath:AT2G33980

ath:AT5G45940

hsa:283927

mmu:67528

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.647

Rank 1 · TkA03G518250 · TK1151

Golgi apparatus0.153

Rank 2 · TkA03G518250 · TK1151

Nucleus0.141

Rank 3 · TkA03G518250 · TK1151

Cytoplasm0.134

Rank 4 · TkA03G518250 · TK1151

Cell membrane0.120

Rank 5 · TkA03G518250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10944DUF263016-59 aa

PF07851TMEM120A-B22-352 aa

PF00293NUDIX177-206 aa

PF11384DUF3188181-190 aa

PF11384DUF3188328-335 aa

PF00293NUDIX376-498 aa

PF10944DUF2630429-440 aa

PF11384DUF3188520-544 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G518250	`PF10944`	DUF2630	16	59	1.8	9.7
TkA03G518250	`PF07851`	TMEM120A-B	22	352	2.3e-92	310.4
TkA03G518250	`PF00293`	NUDIX	177	206	5.4e-14	53.1
TkA03G518250	`PF11384`	DUF3188	181	190	0.19	12.3
TkA03G518250	`PF11384`	DUF3188	328	335	0.19	12.3
TkA03G518250	`PF00293`	NUDIX	376	498	5.4e-14	53.1
TkA03G518250	`PF10944`	DUF2630	429	440	1.8	9.7
TkA03G518250	`PF11384`	DUF3188	520	544	0.19	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYB1`	Arabidopsis thaliana	sp\|Q8GYB1\|NUD15_ARATH Nudix hydrolase 15, mitochondrial	64.700%	Swiss-Prot	High
`Q8LET2`	Arabidopsis thaliana	sp\|Q8LET2\|NUD11_ARATH Nudix hydrolase 11	62.600%	Swiss-Prot	High
`O22951`	Arabidopsis thaliana	sp\|O22951\|NUD22_ARATH Nudix hydrolase 22, chloroplastic	63.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card